SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000054867 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000054867
Domain Number 1 Region: 233-406
Classification Level Classification E-value
Superfamily C-type lectin-like 3.85e-51
Family C-type lectin domain 0.0000000691
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000054867
Domain Number - Region: 95-159
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.000314
Family Occludin/ELL domain 0.0048
Further Details:      
 
Domain Number - Region: 164-224
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.00157
Family Occludin/ELL domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000054867   Gene: ENSPTRG00000010403   Transcript: ENSPTRT00000062312
Sequence length 427
Comment pep:known chromosome:CHIMP2.1.4:19:7849564:7854197:-1 gene:ENSPTRG00000010403 transcript:ENSPTRT00000062312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQV
SKVPSSISQEESRQDVIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKQ
QEIYQELTRLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKMQEIYQELTRLKAAV
GELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVGELPEKSKQQEIYQ
ELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCRRCPWEWTFFQGNCYFMSNSQRNW
HDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNEEGMWQWVDGSPLLP
SFNQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPA
TPNPPPA
Download sequence
Identical sequences ENSPTRP00000054856 ENSPTRP00000054867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]