SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000054996 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000054996
Domain Number 1 Region: 2-153
Classification Level Classification E-value
Superfamily Globin-like 4.88e-40
Family Globins 0.0000000886
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000054996   Gene: ENSPTRG00000023553   Transcript: ENSPTRT00000062439
Sequence length 154
Comment pep:known chromosome:CHIMP2.1.4:22:34299841:34310013:-1 gene:ENSPTRG00000023553 transcript:ENSPTRT00000062439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE
DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLHSKH
PGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Download sequence
Identical sequences A0A1K0FU57 P02145
ENSPTRP00000054996 9598.ENSPTRP00000054996 XP_008973240.1.60992 XP_014198801.1.60992 XP_016794562.1.37143 ENSPTRP00000054996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]