SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000055001 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000055001
Domain Number 1 Region: 45-214
Classification Level Classification E-value
Superfamily vWA-like 5.7e-47
Family Integrin A (or I) domain 0.0008
Further Details:      
 
Domain Number 2 Region: 520-708
Classification Level Classification E-value
Superfamily vWA-like 9.56e-43
Family Integrin A (or I) domain 0.0007
Further Details:      
 
Domain Number 3 Region: 298-519
Classification Level Classification E-value
Superfamily vWA-like 2.22e-38
Family Integrin A (or I) domain 0.0039
Further Details:      
 
Domain Number 4 Region: 713-749
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000362
Family EGF-type module 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000055001   Gene: ENSPTRG00000002959   Transcript: ENSPTRT00000062445
Sequence length 752
Comment pep:known_by_projection chromosome:CHIMP2.1.4:10:113651391:113706232:1 gene:ENSPTRG00000002959 transcript:ENSPTRT00000062445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPFLLLETVCVFLFSRVPPSLPLQEVHVSKETIGKISAASKMMWCSAAVDIMFLLDGSN
SVGKGSFERSKHFAITVCDGLDISPERVRVGAFQFSSTPHLEFPLDSFSTQQEVKARIKR
MVFKGGRTETGLALKYLLHRGLPGGRNASVPQILIIVTDGKSQGDVALPSKQLKERGVTV
FAVGVRFPRWEELHALASEPREQHVLLAEQVEDATNGLFSTLSSSAICSSTTPDCRVEAH
PCERRTLEMVREFAGNAPCWRGSRRTLAVLAAHCPFYSWKRVFLTHPATCYRTTCPGPCD
SQPCQNGGTCVPEGLDGYQCLCPLAFGGEANCALKLSLECRVDLLFLLDSSAGTTLDGFL
RAKVFVKRFVQAVLSKDSRARVGVATYSRELLVAVPVGEYQDVPDLVRSLDGIPFRGGPT
LTGSALRQAAERGFGSATRTGQDRPRRVVVLLTESRSEDEVAGPARHARARELLLLGVGS
EAVRAELEEITGSPKHVMVYSDPHDLLNQISELQGKLCNRQQQGCRTQALDLVFMLDTSA
SVGPENFAQMQSFVRSCALQFEVNPDVTQVGLVVYGSQVQTAFGLDTKPTRAALLRAISQ
APYLGGVGSAGTALLHIYDKVMTVQRGARPGVPKAVVVLTGGRGAEDAAVPAQKLRNNGI
SVLVVGVGPVLSEGLRRLAGPRDSLIHVAAYADLRYHQDVLIEWLCGEAKRPVNICKPSP
CMNEGSCVLQNGSYRCECRDGWEGPHCENRFL
Download sequence
Identical sequences ENSPTRP00000055001 ENSPTRP00000055001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]