SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000055303 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000055303
Domain Number 1 Region: 40-269,368-514
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.55e-63
Family FAD-linked reductases, N-terminal domain 0.00000000000289
Further Details:      
 
Domain Number 2 Region: 270-368
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.28e-37
Family Electron transfer flavoprotein-ubiquinone oxidoreductase-like 0.00000095
Further Details:      
 
Domain Number 3 Region: 516-615
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.32e-28
Family ETF-QO domain-like 0.00000223
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000055303   Gene: ENSPTRG00000016553   Transcript: ENSPTRT00000063758
Sequence length 617
Comment pep:known chromosome:CHIMP2.1.4:4:161771374:161809237:1 gene:ENSPTRG00000016553 transcript:ENSPTRT00000063758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVPLAKLSCLAYQCFHALKIKKNYLPLCATRWSSTSAVPRITTHYTIYPRDKDKRWEGV
NMERFAEEADVVIVGAGPAGLSAAVRLKQLAAAHEKDIRVCLVEKAAQIGAHTLSGACLD
PGAFKELFPDWKEKGAPLNTPVTEDRFGILTEKYRIPVPILPGLPMNNHGNYIVRLGHLV
SWMGEQAEALGVEVYPGYAAAEVLFHDDGSVKGIATNDVGIQKDGAPKATFERGLELHAK
VTIFAEGCHGHLAKQLYKKFDLRANCEPQTYGIGLKELWVIDEKNWKPGRVDHTVGWPLD
RHTYGGSFLYHLNEGEPLVALGLVVGLDYQNPYLSPFREFQRWKHHPSIRPTLEGGKRIA
YGARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGILAAESIFNQLTS
ENLQSKTIGLHVTEYEDNLKNSWVWKELYSVRNIRPSCHGVLGVYGGMIYTGIFYWILRG
MEPWTLKHKGSDFERLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHLTLR
DDSIPVNRNLSIYDGPEQRFCPAGVYEFVPVEQGDGFRLQINAQNCVHCKTCDIKDPSQN
INWVVPEGGGGPAYNGM
Download sequence
Identical sequences K7AY84
ENSPTRP00000055303 ENSPTRP00000055303 9598.ENSPTRP00000055303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]