SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000055306 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000055306
Domain Number 1 Region: 121-219
Classification Level Classification E-value
Superfamily Immunoglobulin 5.67e-26
Family I set domains 0.00000441
Further Details:      
 
Domain Number 2 Region: 27-119
Classification Level Classification E-value
Superfamily Immunoglobulin 3.7e-24
Family I set domains 0.0022
Further Details:      
 
Domain Number 3 Region: 221-317
Classification Level Classification E-value
Superfamily Immunoglobulin 1.72e-22
Family I set domains 0.00000852
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000055306   Gene: ENSPTRG00000028885   Transcript: ENSPTRT00000063761
Sequence length 387
Comment pep:known chromosome:CHIMP2.1.4:19:59656992:59732760:1 gene:ENSPTRG00000028885 transcript:ENSPTRT00000063761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLMVVSMACVGFFLLQGAWPHMGGQDKPFLSAWPSAVVSEGEYVTLQCRSRLGFNEFSL
SKEDGMPVPELYNRVFRNSLFMGPVTPAHAGTYRCRGSHPHFLTGWSAPSNPLVIMVTGV
HRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGKFNDTLRLTGELHDGVSKANF
SIGPMTEDLAGTYRCYGSLTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVWAGESV
TLSCSSQSSYDMYHLSREEGGRERRLPAGPKVNGTFQADFSLGPATHGGTYRCFGSFRDS
PYEWSDPSDPLLVSVTGNPSNSWPSPTEPSTKTGIRRHLHVLIGTSVVIILFILLLFFLL
HRWCSNKKRCCCNGPRACREQNSEQGG
Download sequence
Identical sequences ENSPTRP00000055306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]