SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000055657 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000055657
Domain Number 1 Region: 1219-1395
Classification Level Classification E-value
Superfamily AbfB domain 1.57e-20
Family AbfB domain 0.011
Further Details:      
 
Domain Number 2 Region: 883-947
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000229
Family ATI-like 0.026
Further Details:      
 
Domain Number 3 Region: 776-846
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000343
Family BSTI 0.029
Further Details:      
 
Domain Number 4 Region: 2343-2406
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000114
Family BSTI 0.019
Further Details:      
 
Domain Number 5 Region: 424-474
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000491
Family BSTI 0.047
Further Details:      
 
Domain Number 6 Region: 946-986
Classification Level Classification E-value
Superfamily FnI-like domain 0.000067
Family VWC domain 0.065
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000055657
Domain Number - Region: 484-511
Classification Level Classification E-value
Superfamily PMP inhibitors 0.000497
Family PMP inhibitors 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000055657   Gene: ENSPTRG00000003405   Transcript: ENSPTRT00000064111
Sequence length 2897
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:17346175:17445360:1 gene:ENSPTRG00000003405 transcript:ENSPTRT00000064111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVLASALCWLLCVWLPWGEQAAESLRVQRLGERVVDSGRSGARGMRNVKGMRNGPAQTL
VSSSSSHQEVTLAMGDTATVVGGQQAEAPDSVAMSSWDRRLHRAKCAPSYLFSCFNGGEC
VHPAFCDCRRFNATGPRCQMVYNAGPERDSICRAWGQHHVETFDGLYYYLSGKGSYTLVG
RHEPEGQSFSIQVHNDPQCGSSPYTCSRAVSLFFVGEQEIHLAKEVTHGGMRVQLPHVMG
SVRLQRLAGYVIVRHQSAFTLAWDGASAVYIKMSPELLGWTHGLCGNNNADPKDDLVTSS
GKLTDDVVEFVHSWQEQAPNQPPGPTTSSLPRPPCLQQNPGTMQGVYEQCEALLRPPFDA
CHAYVSPLPFTASCTSDLCQSMGDVATWCRALAEYARACAQAGQPLQGWRTQLRQCTVHC
KEKAFTYNECIACCPASCQPRASCVDSEIACVDGCYCPNGLIFEDGGCVAPAECPCEFHG
TLYPPGSVVKEDCNACTCTSGKWECSTAVCPAECSVTGDIHFTTFDGRRYTFPATCQYIL
AKSRSSGTFTVTLQNAPCGLNQDGACVQSVSVILHHDPRRQVTLTQAGDVLLFDQYKIIP
PYTDDAFEIRRLSSVFLRVRTNVGVRVLYDREGLRLYLQVDQRWVEDTVGLCGTFNGNTQ
DDFLSPVGVPESTPQLFGNSWKTLSACSPLVPGSPLDPCDVHLQAASYSVQACSVLTGEL
FAPCSAFLSPVPYFEQCRRDACRCGQPCLCATLAHYAHLCRRHGLPVDFRARLPACALSC
EASKEYSPCVAPCGRTCQDLASPEACGVDGGDDLSRDECVEGCACPPDTYLDTQADLCVP
RNQCSCHFQGVDYPPGDSDIPSLGHCHCKDGVMSCDSRAPAAACPAGQVFVNCSDLHTDL
ELSRERTCEQQLLNLSMSARGPCLSGCACPQGLLRHGDACFLPEECPCTWKGKEYFPGDQ
VMSPCHTCVCQRGSFQCTLHPCASTCTAYGDRHYRTFDGLPFDFVGACKVHLVKSTSDVS
FSVIVENVNCYSSGMICRKFISINVGNSLIVFDDDSGNPSPESFLDDKQEVHTWRVGFFT
LVHFPREHITLLWDQRTTVHVQAGPQWQGQLAGLCGNFDLKTINEMRTPENLELTNPQEF
GSSWAAVECPDTLDPRDMCVLNPLREPFAKKECSILLSEVFEICHPVVDVTWFYSNCLTD
TCGCSRGGDCECFCASVSAYAHQCCQHGVAVDWRTPRLCPYDCDFFNKVLGKGPYQLSSL
AAGGALVGMKAVGDDIVLVRTEDVAPADIVSFLLTAALYKAKAHDPDVVSLEAADRPNFF
LHVTANGSLELAKWQGHDTFQQHASFLLHRDTRQAGLVALESLAKPSSFLYALGPVLALR
LYEHTEVFRRGTLFRLLDAKPSGAAYPICEWRYDACASPCFQTCRDPQAASCRDVPVEPA
VWVPTEALGNETLPPSQGLPTPSDEEPQLSQESPRIPTHRPALTPAAPLTTALNPPMTAT
EEPVVSPGPTQTTLQQPLELTASQLPAGPTEAPASKGVTASLLAIPHTPESSSLPVALQT
PTPGMVSGAMETTRVTVIFAGSPNITVSSRSPPAPRFPLMTKAVTVRGHGSLPVRTTPLQ
PSLTASPSSRPVASPGAISRSPTSLGSHKAVLTPAVTKVISRTGVPQPTQAQSASSPSTP
LTVARTAAEQVPVSPLATRSLEIVLSTEKGEAGHSQPMGSPASPQPHPLPTAPPRPAQHT
TMATRSPALPPETPAAASLSTATHGLAATPFMSLESTRPSQLLSGLPPDTSLPLAKVGTS
APVATPGPKASVITTPLQPQATTLPAQTLSPVLPFTPAAMTQAHPPAHIAPPAAGTAPGL
LLGATLPTSGVLPVAEGTASMVSVVPRKSTTGKVAILSKQVSLPTSMYGSAEGGPTELMP
ATSHPLTPLVAEPEGAQAGTALPVPTSYPLSRVSARTAPQDSMLVLLPQLAEAHGTSAGP
HLAAEPVDEATTEPSGHSAPALSIVEGLAEALATTTEANTSTTCVPIAEQDCVRHICLEG
QLIRVNQSQHCPQGAAPPRCGILGLAVRVGGDRCCPLWECACRCSIFPDLSFVTFDGSHV
ALFKEAIYILSQSPDEMVTVHVLDCKSANLGHLNWPPFCLVMLNMTHLAHQVTIDRFNRK
VTVDSQPVWPPVTRYGFRIEDTGHMYMILTPSDIQIQWLHSSGLMIVEASKTSKAQGHGL
CGICDGDAANDLTLKDGSVVGGAEDPAPFLDSWQVPSSLTSVGQTRFRPDSCATTDCSPC
LRMVSNRTFSACHRFVPPESFCELWIRDTKYVQQPCVALTVYVAMCHKFHVCIEWRRSDY
CPFLCSSDSTYQACVTACEPPKTCQDGTLGPLDPEHCQVLGEGCVCSEGTILHRRHSALC
IPEAKCACTDSMGVPRALGETWNSSLSGCCQHQCQASDTIVPVDLGCPSPRPESCLRFGE
VALLLPTKDPCCLGTVCVCNQTLCEGLAPTCRPGHRLLTHFQEDSCCPSYSCECDPDLCE
AELVPSCRQDQILIAGRLGDSCCTSYFCACGDCPDSIPECQEGEALTVHRNTTELCCPLY
QCVCEKFRCPQVQCGLGTALVEVWSPDRCCPYKSCECDCDTIPVPRCHLWEKSQLDEEFM
HSVENVCGCAKYECVKAPVCLSRELGVMQPGQTVVELSADGVCHTSRCTTVLDPLTSFYQ
INTTSVLCDIHCEANQEYEHPRDLAACCGSCRNVSCLFTFPNGTTSLFLPGASWIADCAR
HHCSSTPLGAVLVRSPISCPPLNETECAKVGGSVVPSLEGCCRTCKEDGRSCKKVTIRMT
IRKNECRSSTPVNLVSCDGRCPSASIYNYNINTYARFCKCCREVGLQRRSVQLFCATNAT
WVPYTVQEPTDCACQWS
Download sequence
Identical sequences ENSPTRP00000055657 ENSPTRP00000055657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]