SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000055839 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000055839
Domain Number 1 Region: 229-520
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.16e-74
Family WD40-repeat 0.000000000028
Further Details:      
 
Domain Number 2 Region: 129-226
Classification Level Classification E-value
Superfamily F-box domain 3.27e-26
Family F-box domain 0.00000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000055839   Gene: ENSPTRG00000002869   Transcript: ENSPTRT00000064287
Sequence length 544
Comment pep:known_by_projection chromosome:CHIMP2.1.4:10:100545584:100741716:1 gene:ENSPTRG00000002869 transcript:ENSPTRT00000064287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPAEAVLQEKALKFMCSMPRSLWLGCSSLADSMPSLRCLYNPGTGALTAFQNSSEREDC
NNGEPPRKIIPEKNSLRQTYNSCARLCLNQETVCLGSTAMKTENCVAKTKLANGTSSMIV
PKQRTRGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRG
LAERRGWGQYLFKNKPPDGNAPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRSE
TSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSS
DSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRV
LVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVS
GSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRA
PAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAQAEPPRSPSRTYT
YISR
Download sequence
Identical sequences ENSPTRP00000055839 ENSPTRP00000055839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]