SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000055846 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000055846
Domain Number 1 Region: 212-421
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-27
Family SPRY domain 0.02
Further Details:      
 
Domain Number 2 Region: 453-603
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000124
Family Nucleotide and nucleoside kinases 0.031
Further Details:      
 
Domain Number 3 Region: 2-39
Classification Level Classification E-value
Superfamily SAP domain 0.0000000641
Family SAP domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000055846   Gene: ENSPTRG00000034359   Transcript: ENSPTRT00000064294
Sequence length 747
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:60637524:60652666:-1 gene:ENSPTRG00000034359 transcript:ENSPTRT00000064294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVKRLKVTELRSELQRRGLDSRGLKVDLAQRLQEALDAEMLEDEAGGGGAGPGGACKAE
PRPVAASGGGPGGDEEEDEEEEEEDEEALLEDEDEEPPPAQALGQAAQPPPEPPEAAAME
AAAEPDVSEKPAEATAGSGGVNGGEEQGPGKGEEDEPEERSGDETPGSEAPGDKAAEEQG
DDQDSEKSKPAGSDGERRGVKRQRDEKDEHGRAYYEFREEAYHSRSKSPLPPEEEAKDEE
EDQTLVNLDTYTSDLHFQVSKDRYGGQPLFSEKFPTLWSGARSTYGVTKGKVCFEAKVTQ
NLPMKEGCTEVSLLRVGWSVDFSRPQLGEDEFSYGFDGRGLKAENGQFEEFGQTFGENDV
IGCFANFETEEVELSFSKNGEDLGVAFWISKDSLADRALLPHVLCKNCVVELNFGQKEEP
FFPPPEEFVFIHAVPVEERVRTAVPPKTIEECEVILMVGLPGSGKTQWALKYAKENPEKR
YNVLGAETVLNQMRMKGLKEPEMDPKSRDLLVQQASQCLSKLVQIASRTKRNFILDQCNV
YNSGQRRKLLLFKTFSRKVVVVVPNEEDWKKRLELRKEVEGDDVPESIMLEMKANFSLPE
KCDYMDEVTYGELEKEEAQPIVTKYKEEARKLLPPSEKRTNRRNNRNKRNRQNRSRGQGY
VGGQRRGYDNRAYGQQYWGQPGNRGGYRNFYDRYRGDYDRFYGRDYEYNRYRDYYRQYNR
DWQSYYYHHPQDRDRYYRNYYGYQGYR
Download sequence
Identical sequences 9598.ENSPTRP00000055846 ENSPTRP00000055846 ENSPTRP00000055846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]