SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000056006 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000056006
Domain Number - Region: 41-91
Classification Level Classification E-value
Superfamily FnI-like domain 0.000732
Family Fibronectin type I module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000056006   Gene: ENSPTRG00000034256   Transcript: ENSPTRT00000064451
Sequence length 139
Comment pep:known_by_projection chromosome:CHIMP2.1.4:9:36187837:36189125:-1 gene:ENSPTRG00000034256 transcript:ENSPTRT00000064451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRMLWAGQAKGILGGWGIICLVMSLLLQHPGVYSKCYFQAQAPCHYEGKYFTLGESWL
RNDCFHCTCLHPVGVGCCDTSQHPIDFPAGCEVRQEAGTCQFSLVQKSDPRLPCKGGGPD
PEWGSANTPVPGAPAPHSS
Download sequence
Identical sequences H2RBN6
XP_001168039.1.37143 ENSPTRP00000056006 9598.ENSPTRP00000056006 ENSPTRP00000056006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]