SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000056036 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000056036
Domain Number 1 Region: 16-365
Classification Level Classification E-value
Superfamily Phosphofructokinase 2.05e-186
Family Phosphofructokinase 0.007
Further Details:      
 
Domain Number 2 Region: 403-731
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.24e-148
Family Phosphofructokinase 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000056036   Gene: ENSPTRG00000004874   Transcript: ENSPTRT00000064480
Sequence length 780
Comment pep:known chromosome:CHIMP2.1.4:12:41219364:41246799:-1 gene:ENSPTRG00000004874 transcript:ENSPTRT00000064480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVD
GGDHIKEATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAYNLVKRGITNLCVIGGDG
SLTGADTFRSEWSDLLSDLQKAGKITDEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDS
ALHRIMEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWE
EHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQ
RGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTK
AMDEKKFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSGSHTVAVMNVGAPAAGMNAAVR
STVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSFEQ
ISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATVSNNVPGSDFSV
GADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPF
TIRDLQANVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLG
HMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVF
QPVAELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHAHLEHITRKRSGEAAV
Download sequence
Identical sequences A0A024R0Y5 A0A2J8LQF8 P08237
ENSPTRP00000056036 4omt_A NP_000280.1.87134 NP_000280.1.92137 NP_001160159.1.87134 NP_001160159.1.92137 NP_001160160.1.87134 NP_001160160.1.92137 XP_003825834.1.60992 XP_003825836.1.60992 XP_004053082.1.27298 XP_008949377.1.60992 XP_008949378.1.60992 XP_008949379.1.60992 XP_008949381.1.60992 XP_011536790.1.92137 XP_016779020.1.37143 XP_016779022.1.37143 XP_016779023.1.37143 XP_016779024.1.37143 XP_016779025.1.37143 XP_016779026.1.37143 XP_018894168.1.27298 XP_018894169.1.27298 ENSP00000309438 ENSP00000352842 ENSP00000449426 9606.ENSP00000352842 gi|266453748|ref|NP_001160159.1| gi|266453768|ref|NP_001160160.1| gi|4505749|ref|NP_000280.1| 400577 ENSPTRP00000056036 ENSP00000309438 ENSP00000352842 ENSP00000449426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]