SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000056558 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000056558
Domain Number 1 Region: 494-527,566-632
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000147
Family Anti-sigma factor antagonist SpoIIaa 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000056558   Gene: ENSPTRG00000033891   Transcript: ENSPTRT00000064992
Sequence length 663
Comment pep:known_by_projection chromosome:CHIMP2.1.4:8:89427006:89574513:1 gene:ENSPTRG00000033891 transcript:ENSPTRT00000064992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGAKRKKKSMLWSKMHTPQCEDIIQWCRRRLPILDWAPHYNLKENLLPDTVSGIMLAVQ
QVTQGLAFAVLSSVHPVFGLYGSLFPAIIYAIFGMGHHVATGTFALTSLISANAVERIVP
QNMQNLTTQSNTSVLGLSDFEMQRIHVAAAVSFLGGVIQVAMFVLQLGSATFVVTEPVIS
AMTTGAATHVVTSQVKYLLGMKMPYISGPLGFFYIYAYVFENIKSVRLEALLLSLLSIVV
LVLVKELNEHFKRKXXXXXXXGTTQIIAASFACYCTNMENTYGLEVVGHIPQGIPSPRAP
PMNILSAVITEAFGVALVGYVASLALAQGSAKKFKYSIDDNQEFLAHGLSNIVSSFFFCI
PSAAAMGRTAGLYSTGAKTQVACLISCIFVLIVIYAIGPLLYWLPMCVLASIIVVGLKGM
LIQFRDLKKYWNVDKIDWGIWVSTYVFTICFAANVGLLFGVVCTIAIVIGRFPRAMTVSI
KNMKEMEFKAKTEMDSETLQQVKIISINNPLVFLNAKKFYTDLMNIIQKENACNQPLDDI
SKCEQNTLLNSLSNGNCNEEASQSCPNEKCSLILDCSGFTFFDSSGVSMLVEVYMDCKGR
SVDVLLAHCTASLIKAMTYYGNLDSEKPIFFESVSAAISHIHSNKASYKLLFDNLDLPTM
PPL
Download sequence
Identical sequences ENSPTRP00000056558 ENSPTRP00000056558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]