SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000056827 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000056827
Domain Number 1 Region: 119-217
Classification Level Classification E-value
Superfamily Immunoglobulin 1.32e-27
Family I set domains 0.0000107
Further Details:      
 
Domain Number 2 Region: 26-117
Classification Level Classification E-value
Superfamily Immunoglobulin 3.24e-26
Family I set domains 0.0027
Further Details:      
 
Domain Number 3 Region: 219-315
Classification Level Classification E-value
Superfamily Immunoglobulin 8.66e-25
Family I set domains 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000056827   Gene: ENSPTRG00000028885   Transcript: ENSPTRT00000065263
Sequence length 442
Comment pep:known chromosome:CHIMP2.1.4:19:59767038:59783109:1 gene:ENSPTRG00000028885 transcript:ENSPTRT00000065263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLMVVSMACVGFFLLQRACPHMGGHDKPFLSAWSSAVVPRGGHVTLRCHYRGGFNNFML
YKEDRIHVPIGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHR
KPSLLAHPGPLVRSGETVILQCWSDVMFEHFFLHREGISQDPSRLVGQIHDGVSKANFSI
GPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIMVTGLYEKPSLSAQPGPTVQAGENVTL
SCSSRRSYDMYHLFREGEAHECRLRAVRKVNRTFQADFPLGPATHRGTYRCFGSFRHSPY
EWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGIRRHLHILIGTSVVIILFIIILFFLLHR
WCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTYAQLDHCVFIQRKIGRPSQRPKTPL
TDTSVYTELPNAEPRSKVVSCP
Download sequence
Identical sequences ENSPTRP00000019727 ENSPTRP00000056827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]