SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000056879 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000056879
Domain Number - Region: 496-537
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0116
Family EGF-type module 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000056879   Gene: ENSPTRG00000020924   Transcript: ENSPTRT00000065310
Sequence length 650
Comment pep:known chromosome:CHIMP2.1.4:9:36267210:36285959:1 gene:ENSPTRG00000020924 transcript:ENSPTRT00000065310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPTPRLKSGFQLPPALLLLLLFSVLGPGAGGLFLTDYSTCSPRKLSPFRSFASTELFHFH
VPEDTFLAVWNLIIFKEQGGTFGDHCPDQSVTVYFRSGAPPVINPLHTHFPGDTAVPGVF
SLTLSWTLPNRTSGIFNVSSPLPGDWFLAAHLPQAHGHISVKGLQDECQYLLQPQLIVRR
LLDVAVLVPGRPSEQTLSPHNRSALYKVFVPSFTYRVSAQLVCVGGRGVSACPLSLRLRP
KAPPLHNSSSVACGGASGCQLELALPPWGHWVYVRVETSSRGPGRTIRFQLCVRLQECPQ
PGLLRALVPGAAMNMPQSLGNQPLPPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDT
FSVHFYIFFGPSVALPPERPAVFAMRLLPVLDSGGVLSLELQLNASSVRQENVTVFGCLT
HEVPLSLGDAAVTCSKESLAGFLLSVSATTRVARLRIPFPQTGTWFLALRSLCGVGPRFV
RCRNATAEVRMRTFLSPCVDDCGPYGQCKLLRTHNYLYAACECKAGWRGWGCTDSADALT
YGFQLLSTLLLCLSNLMFLPPVVLAIRSRYVLEAAVYTFTMFFSTVCGGVCILSLGACAW
WWVTVCISTTFSEGLGMSVPSLCLLQTETAVLPKLSCIDNGHFCKAHWSK
Download sequence
Identical sequences ENSPTRP00000056879 ENSPTRP00000056879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]