SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000056904 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000056904
Domain Number 1 Region: 9-120
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 4.25e-39
Family MHC antigen-recognition domain 0.0000245
Further Details:      
 
Domain Number 2 Region: 120-216
Classification Level Classification E-value
Superfamily Immunoglobulin 2.88e-27
Family C1 set domains (antibody constant domain-like) 0.0000246
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000056904   Gene: ENSPTRG00000018030   Transcript: ENSPTRT00000065338
Sequence length 258
Comment pep:novel chromosome:CHIMP2.1.4:6:33494915:33506071:1 gene:ENSPTRG00000018030 transcript:ENSPTRT00000065338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYVYQGRQECYAFNGTQRYLERYIYN
REEYARFDSDVGEFRAVTELGRPAAEYWNSQKDLLEEKRAVPDRMCRHNYELNEAVTLQR
RVQPKVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDW
TFQILVMLEMTPQQGDVYICQVEHTSLDSPVTVEWKAQSDSARSKTLTGAGGFVLGLIIC
GVGIFMHRRSKKVQRGSA
Download sequence
Identical sequences H2RC77
ENSPTRP00000056904 ENSPTRP00000056904 XP_518391.3.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]