SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000057066 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000057066
Domain Number 1 Region: 58-122
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000146
Family Ngr ectodomain-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000057066   Gene: ENSPTRG00000033843   Transcript: ENSPTRT00000065502
Sequence length 206
Comment pep:known chromosome:CHIMP2.1.4:22:18140597:18141828:1 gene:ENSPTRG00000033843 transcript:ENSPTRT00000065502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGPRGALSLLLLLLAPPSRPAAGCPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTEL
VLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVA
PPALRGRLLPYLAEDELRAACAPGPLCWGALAAQLALLGLGLLHALLLVLLLCRLRRLRA
RARARAAARLSLTDPLVAERAGTDEF
Download sequence
Identical sequences H2RCB6
XP_009436066.1.37143 9598.ENSPTRP00000057066 ENSPTRP00000057066 ENSPTRP00000057066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]