SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000057074 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000057074
Domain Number 1 Region: 17-73
Classification Level Classification E-value
Superfamily GLA-domain 2.86e-21
Family GLA-domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000057074   Gene: ENSPTRG00000021786   Transcript: ENSPTRT00000065509
Sequence length 215
Comment pep:known chromosome:CHIMP2.1.4:X:37756363:37784686:1 gene:ENSPTRG00000021786 transcript:ENSPTRT00000065509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFLTGEKANSVLKRYPRANGFFEEIRQGNIERECKEEFCTFEEAREAFENNEKTKEFWST
YTKAQQGESNRGSDWFQFYLTFPLIFGLFIILLVIFLIWRCFLRNKTRRQTVTEGHIPFP
QHLNIITPPPPPDEVFDSSGLSPGFLGYVVGRSDSVSTRLSNCDPPPTYEEATGQVNLQR
SETEPHLDPPPEYEDIVNSNSASAIPMVPVVTTIK
Download sequence
Identical sequences ENSPTRP00000057074 ENSPTRP00000057074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]