SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000057178 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000057178
Domain Number 1 Region: 318-448,480-601
Classification Level Classification E-value
Superfamily ARM repeat 3.7e-31
Family Pumilio repeat 0.018
Further Details:      
 
Domain Number 2 Region: 76-209,239-399
Classification Level Classification E-value
Superfamily ARM repeat 1.73e-30
Family Pumilio repeat 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000057178   Gene: ENSPTRG00000033813   Transcript: ENSPTRT00000065613
Sequence length 634
Comment pep:known_by_projection chromosome:CHIMP2.1.4:14:23150872:23160139:1 gene:ENSPTRG00000033813 transcript:ENSPTRT00000065613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQGPRSPHKVGRRFPAGGKRGRGAKGSGRPLPGRKRQPWPPPDGRSEPAPDSHPHLSPE
ALGYFRRALSALKEAPETGEERDLMVHNIMKEVETQALALSTNRAGSEMLQELLGFSPLK
PLCRVWAALRSNLLTVACHRCGVHVLQSALLQLPRLLGSAAEEEEEEDGKDGPTETLEEL
VLGLAAEVCDDFLVYCGDTHGSFVVRTLLQVLGGTILESERARPRGSQSSEAQKTPAQEC
KPADFEVPETFLNRLQDLSSSFLKDIAVFTTDKISSFCLQVALQVLHRKLPQFCAHLCNA
VIGYLSTRSSSVDGSPLLLFLRDQTSSRLLEQVLLVLEPPRLQSLFEEHLQGQLQTLAAH
PIANFPLQRLLDAVTTPELLSPVFEELSPVLEAVLAQGHPGVVIALVGACRRVGAYQAKV
LQLLLEAFHCAEPSSRQAACVPLFATLMAYEVYYGLTEEEGAVPAEHQVAVAAARALGDV
TVLGSLLLQHLLHFSTPGLVLRSLGALTGPQLLSLAQSPAGSHVLDAILTSPSVTRKLRR
RVLQNLKGQYVALACSRHGSRVLDAIWSGAALRARKEIAAELGEQNQELIRDPFGHHVAR
NVALTTFLKRREAWEQQQGAVAKRRRALNSILED
Download sequence
Identical sequences ENSPTRP00000057178 ENSPTRP00000057178 9598.ENSPTRP00000057178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]