SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000057254 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000057254
Domain Number 1 Region: 35-145
Classification Level Classification E-value
Superfamily Immunoglobulin 5.17e-18
Family V set domains (antibody variable domain-like) 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000057254   Gene: ENSPTRG00000034155   Transcript: ENSPTRT00000065690
Sequence length 231
Comment pep:novel chromosome:CHIMP2.1.4:1:207665168:207667047:-1 gene:ENSPTRG00000034155 transcript:ENSPTRT00000065690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVMCDPEAFLSICFVTLVFPQLPLASIWKVDFDVTGPHAPILAMAGGHVELQCQLFPNI
SAEDMELRWYRCQPSLAVHMHERGMDMDGEQKWQYRGRTTFMSDQVARGKAMVRSHRVTT
FDNGTYCCRFKDGVKFGEATVQVQVAGLGTEPRIQVTDQQDGVRAECTSAGYFPKSWVER
RDFRGQARPAVTNLSASATTRLWAVASSLTLWDRAVEGLSCSISSPLLPER
Download sequence
Identical sequences 9598.ENSPTRP00000057254 ENSPTRP00000057254 ENSPTRP00000057254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]