SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000057370 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000057370
Domain Number 1 Region: 637-850
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.7e-102
Family Thrombospondin C-terminal domain 0.00000012
Further Details:      
 
Domain Number 2 Region: 510-635
Classification Level Classification E-value
Superfamily TSP type-3 repeat 8.24e-35
Family TSP type-3 repeat 0.00000517
Further Details:      
 
Domain Number 3 Region: 126-171
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 1.2e-17
Family Assembly domain of cartilage oligomeric matrix protein 0.00096
Further Details:      
 
Domain Number 4 Region: 430-512
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.11e-16
Family TSP type-3 repeat 0.00015
Further Details:      
 
Domain Number 5 Region: 281-321
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000354
Family EGF-type module 0.012
Further Details:      
 
Domain Number 6 Region: 199-253
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000142
Family EGF-type module 0.029
Further Details:      
 
Domain Number 7 Region: 8-63
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000095
Family Laminin G-like module 0.049
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000057370
Domain Number - Region: 331-373
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00458
Family EGF-type module 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000057370   Gene: ENSPTRG00000017031   Transcript: ENSPTRT00000065803
Sequence length 868
Comment pep:known_by_projection chromosome:CHIMP2.1.4:5:35414917:35462465:-1 gene:ENSPTRG00000017031 transcript:ENSPTRT00000065803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRLNKAILRYLKNDGKVHLVVFNNLQLADGRRHRILLRLSNLQRGAGSLELYLDCIQVD
SIHNLPRAFAGPSQKPETIELRTFQRKPQDFLEELKLVVRGSLFQVASLQDCFLQQSEPL
AATGTGDFNRQFLGQMTQLNQLLGEVKDLLRQQVKETSFLRNTIAECQACGPLKFQSPTP
STVVPPAPPAPPTRPPRRCDSNPCFRGVQCTDSRDGFQCGPCPEGYTGNGITCIDVDECK
YHPCYPGVRCINLSPGFRCDACPVGFTGPMVQGVGISFAKSNKQVCTDIDECRNGACVPN
SICVNTLGSYRCGPCKPGYTGDQIRGCKAERNCRNPELNPCSVNAQCIEERQGDVTCVCG
VGWAGDGYICGKDVDIDSYPDEELPCSARNCKKDNCKYVPNSGQEDADRDGIGDACDEDA
DGDGILNEQDNCVLIHNVDQRNSDKDIFGDACDNCLSVLNNDQKDTDGDGRGDACDDDMD
GDGIKNILDNCPKFPNRDQRDKDGDGVGDACDSCPDVSNPNQSDVDNDLVGDSCDTNQDS
DGDGHQDSTDNCPTVINSAQLDTDKDGIGDECDDDDDNDGIPDLVPPGPDNCRLVPNPAQ
EDSNSDGVGDICESDFDQDQVIDRIDVCPENAEVTLTDFRAYQTVVLDPEGDAQIDPNWV
VLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTQTDDDYAGFIFGYQDSSSHHMW
KQTEQTYWQATPFRAVAEPGIQLKAVKSKTGPGEHLRNSLWHTGDTSDQVRLLWKDSRNV
GWKDKVSYRWFLQHRPQVGYIRVRFYEGSELVADSGVTIDTTMRGGRLGVFCFSQENIIW
SNLKYRCNDTIPEDFQEFQTQNFDRFDN
Download sequence
Identical sequences ENSPTRP00000057370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]