SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000057441 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000057441
Domain Number 1 Region: 509-724
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.5e-104
Family Thrombospondin C-terminal domain 0.000000089
Further Details:      
 
Domain Number 2 Region: 386-507
Classification Level Classification E-value
Superfamily TSP type-3 repeat 2.22e-35
Family TSP type-3 repeat 0.00000307
Further Details:      
 
Domain Number 3 Region: 28-73
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 2.48e-17
Family Assembly domain of cartilage oligomeric matrix protein 0.00012
Further Details:      
 
Domain Number 4 Region: 318-388
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000000129
Family TSP type-3 repeat 0.00019
Further Details:      
 
Domain Number 5 Region: 241-329
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000000484
Family TSP type-3 repeat 0.00013
Further Details:      
 
Domain Number 6 Region: 120-159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000198
Family EGF-type module 0.027
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000057441
Domain Number - Region: 90-131
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0947
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000057441   Gene: ENSPTRG00000010720   Transcript: ENSPTRT00000065872
Sequence length 737
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:19090215:19098896:-1 gene:ENSPTRG00000010720 transcript:ENSPTRT00000065872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPDTACVLLLTLAALGASGQGQSPLGSDLGPQMLRELQETNAALQDVRELLRQQVREIT
FLKNTVMECDACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTG
NGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSGPTHEGVGLAFAKANKQVCTD
INECETGQHNCVPNSVMQTASRARWLASCVSAAGWLEAGLGGGHSRAPTYTLPQCAVGWA
GNGILCGRDTDLDGFPDEKLRCPERQCRKDNCVTVPNSGQEDVDRDGIGDACDPDADGDG
VPNEKDNCPLVRNPDQRNTDEDKWGDACDNCRSQKNDDQKDTDQDGRGDACDDDIDGDRI
RNQADNCPRVPNSDQKDSDGDGIGDACDNCPQKSNPDQADVDHDFVGDACDSDQDQDGDG
HQDSRDNCPTVPNSAQEDSDHDGQGDACDDDDDNDGVPDSRDNCRLVPNPGQEDADRDGV
GDVCQDDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLDPEGDAQIDPNWVVLNQGREI
VQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQMEQT
YWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDTESQVRLLWKDPRNVGWKDKK
SYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGGRLGVFCFSQENIIWANLRYR
CNDTIPEDYETHQLRRA
Download sequence
Identical sequences ENSPTRP00000057441 ENSPTRP00000057441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]