SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000057448 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000057448
Domain Number 1 Region: 179-577,658-663,694-736
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.08e-95
Family FAD-linked reductases, N-terminal domain 0.00000000000069
Further Details:      
 
Domain Number 2 Region: 562-670
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.5e-30
Family L-aminoacid/polyamine oxidase 0.000000845
Further Details:      
 
Domain Number 3 Region: 74-180
Classification Level Classification E-value
Superfamily Homeodomain-like 1.52e-30
Family SWIRM domain 0.00000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000057448   Gene: ENSPTRG00000000321   Transcript: ENSPTRT00000065879
Sequence length 759
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:23035007:23087989:1 gene:ENSPTRG00000000321 transcript:ENSPTRT00000065879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEYREMDESLANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGQAGG
LQDDSSGGYGDGQASGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRT
LQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKK
TGKVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGL
GGNPMAVVSKQVNMELAKIKQKCPLYEANGQADTVKVPKEKDEMVEQEFNRLLEATSYLS
HQLDFNVLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKE
KIKELHQQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEA
NPPSDVYLSSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSC
VPVALAEGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQ
PPAVQFVPPLPEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFL
FWNLYKAPILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRA
DPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHG
ALLSGLREAGRIADQFLGAMYTLPRQATPGVPAQQSPSM
Download sequence
Identical sequences ENSPTRP00000045723 ENSPTRP00000057448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]