SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Pan troglodytes 76_2.1.4 > ENSPTRP00000057474

Domain assignment for ENSPTRP00000057474 from Pan troglodytes 76_2.1.4

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSPTRP00000057474
Domain Number 1	Region: 24-63
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.00000000000969
Family	LDL receptor-like module	0.00085
Further Details:

Domain Number 2	Region: 158-194
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.00000000061
Family	EGF-type module	0.0071
Further Details:

Domain Number 3	Region: 71-106
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.00000000537
Family	LDL receptor-like module	0.0022
Further Details:

Domain Number 4	Region: 118-160
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.000000184
Family	EGF-type module	0.031
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSPTRP00000057474 Gene: ENSPTRG00000005122 Transcript: ENSPTRT00000065904
Sequence length	292
Comment	pep:known_by_projection chromosome:CHIMP2.1.4:12:32211667:32231773:-1 gene:ENSPTRG00000005122 transcript:ENSPTRT00000065904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MLTPPLLLLLPLLSALVAAAIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEA PEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELRGNCSRLGC QHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYL LQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANE TVCWVHVGDNAAQTQLKCARMPGLKGFVDEHTINISLSLHLCVFSKSQQEMG
Download sequence
Identical sequences	A0A2I2YXG0 H2RCK9 ENSPTRP00000057474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]