SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000057564 from Pan troglodytes 76_2.1.4

(show help)
Strong hits

Sequence:	ENSPTRP00000057564
Domain Number 1	Region: 2-59
Classification Level	Classification	E-value
Superfamily	KRAB domain (Kruppel-associated box)	9.29e-25
Family	KRAB domain (Kruppel-associated box)	0.001
Further Details:

Domain Number 2	Region: 293-350
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	3.43e-24
Family	Classic zinc finger, C2H2	0.005
Further Details:

Domain Number 3	Region: 209-266
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	2.85e-23
Family	Classic zinc finger, C2H2	0.0056
Further Details:

Domain Number 4	Region: 335-387
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	1.1e-19
Family	Classic zinc finger, C2H2	0.0054
Further Details:

Domain Number 5	Region: 377-427
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	2.17e-17
Family	Classic zinc finger, C2H2	0.0038
Further Details:

Domain Number 6	Region: 256-288
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	0.0000000000198
Family	Classic zinc finger, C2H2	0.0083
Further Details:

Domain Number 7	Region: 154-210
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	0.000000000134
Family	Classic zinc finger, C2H2	0.028
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

External link(s)	Protein: ENSPTRP00000057564 Gene: ENSPTRG00000033786 Transcript: ENSPTRT00000065990
Sequence length	427
Comment	pep:known_by_projection chromosome:CHIMP2.1.4:7:62564153:62599521:1 gene:ENSPTRG00000033786 transcript:ENSPTRT00000065990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MGVLTFRDVAVEFSPEEWECLDSAQQRLYRDVMLENYGNLVSLGLAIFKPDLMTCLEQRK EPWKVKRQEAVAKHPAGSFHFTAEILPDHDIKDSFQKVILRKYGSCDLNNLHLKKDYQSV GNCKGQKSSYNGLHQCLSITHSKTCQCNKCGRAFQLCSIFTEHKDIFSREKCHKCEECGK DCRLFSDFTRCKKIHTVERCYKCEECGKAFKKFSNLTEHKRVHTGEKPYKCEGCGKTFTC SSTLVKHKRNHTGDRPYKCEECGKAFKCFSDLTNHKRIHTGEKPYKCEECNKAYRWFSDL AKHKIIHTGDKPYKCNECGKAFKWFSALSKHKRIHTGEKPYICEECGKAFTRSSTLFNHK RIHMEERPYKCEECGKTFKCFSDLTNHKRIHTGEKPYKCEECGKASSWFSHLIRHKRIHT REKLHKC
Download sequence
Identical sequences	H2RCN2 XP_009451411.1.37143 ENSPTRP00000057564 ENSPTRP00000057564

SEARCH