SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000057764 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000057764
Domain Number 1 Region: 3873-4066
Classification Level Classification E-value
Superfamily Fibronectin type III 1.52e-37
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 2 Region: 4529-4735
Classification Level Classification E-value
Superfamily Fibronectin type III 1.27e-35
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 3 Region: 4268-4443
Classification Level Classification E-value
Superfamily Fibronectin type III 1.2e-33
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 4 Region: 3515-3681
Classification Level Classification E-value
Superfamily Fibronectin type III 8.74e-32
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 5 Region: 2531-2674
Classification Level Classification E-value
Superfamily Fibronectin type III 1.94e-31
Family Fibronectin type III 0.004
Further Details:      
 
Domain Number 6 Region: 1054-1243
Classification Level Classification E-value
Superfamily Fibronectin type III 2.1e-30
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 7 Region: 4732-4932
Classification Level Classification E-value
Superfamily Fibronectin type III 2.15e-30
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 8 Region: 1707-1895
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.24e-30
Family Laminin G-like module 0.0017
Further Details:      
 
Domain Number 9 Region: 1519-1683
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.3e-29
Family Laminin G-like module 0.0058
Further Details:      
 
Domain Number 10 Region: 2329-2533
Classification Level Classification E-value
Superfamily Fibronectin type III 5.64e-29
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 11 Region: 2819-3005
Classification Level Classification E-value
Superfamily Fibronectin type III 6.67e-28
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 12 Region: 2142-2329
Classification Level Classification E-value
Superfamily Fibronectin type III 5.66e-26
Family Fibronectin type III 0.003
Further Details:      
 
Domain Number 13 Region: 1242-1288,1319-1409
Classification Level Classification E-value
Superfamily Fibronectin type III 4.23e-25
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 14 Region: 3688-3867
Classification Level Classification E-value
Superfamily Fibronectin type III 3.15e-24
Family Fibronectin type III 0.0059
Further Details:      
 
Domain Number 15 Region: 2012-2143
Classification Level Classification E-value
Superfamily Fibronectin type III 3.61e-24
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 16 Region: 1898-2056
Classification Level Classification E-value
Superfamily Fibronectin type III 2.69e-22
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 17 Region: 2688-2821
Classification Level Classification E-value
Superfamily Fibronectin type III 1.16e-21
Family Fibronectin type III 0.0041
Further Details:      
 
Domain Number 18 Region: 3020-3149
Classification Level Classification E-value
Superfamily Fibronectin type III 8.56e-21
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 19 Region: 4024-4155
Classification Level Classification E-value
Superfamily Fibronectin type III 3.94e-20
Family Fibronectin type III 0.0047
Further Details:      
 
Domain Number 20 Region: 121-291
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-18
Family Clostridium neurotoxins, the second last domain 0.084
Further Details:      
 
Domain Number 21 Region: 4149-4264
Classification Level Classification E-value
Superfamily Fibronectin type III 1.36e-17
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 22 Region: 1424-1508
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000599
Family Fibronectin type III 0.0054
Further Details:      
 
Domain Number 23 Region: 4438-4540
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000827
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 24 Region: 3446-3510
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000911
Family Fibronectin type III 0.0049
Further Details:      
 
Domain Number 25 Region: 847-897
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000137
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 26 Region: 641-691
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000176
Family Laminin-type module 0.0056
Further Details:      
 
Domain Number 27 Region: 900-942
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000209
Family Laminin-type module 0.0059
Further Details:      
 
Domain Number 28 Region: 694-744
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000268
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 29 Region: 747-789
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000474
Family Laminin-type module 0.0071
Further Details:      
 
Domain Number 30 Region: 575-627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000586
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 31 Region: 795-844
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000698
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 32 Region: 1002-1050
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Laminin-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000057764
Domain Number - Region: 951-995
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000103
Family Laminin-type module 0.011
Further Details:      
 
Domain Number - Region: 518-572
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000255
Family Laminin-type module 0.046
Further Details:      
 
Domain Number - Region: 339-415
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0153
Family beta-mannanase CBM 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000057764   Gene: ENSPTRG00000001984   Transcript: ENSPTRT00000066189
Sequence length 5225
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:194781813:195590310:-1 gene:ENSPTRG00000001984 transcript:ENSPTRT00000066189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNCPVLSLGSGFLFQVIEMLIFAYFASISLAESRGLFPRLKNVGAFKKVSIVPTQAVCGL
PDRSTFCHSSAAAESIQFCTQRFCIQDCPYRSSHPTYTALFSAGLSSCITPDKNDLHPNA
HSNSTSFIFGNHKSCFSSPPSPKLMASFTLAVWLKPEQQGVMCVIEKTVDGQIVFKLTIS
EKETVFYYRTVNGLQPPIKVMTLGRILVKKWIHLSVQVHQTKISFFINGVEKDHTPFNAR
TLSGSITDFASGTVQIGQSLNGLEQFVGRMQDFRLYQVALTNREILEVFSGDLLRLHAQS
HCRCPGSHPRVHPLAQRYCIPNDAGDTADNRVSRLNPEAHPLSFVNDNDVGTSWVSNVFT
NITQLNQGVTISVDLENGQYQVFYIIIQFFSPQPTEIRIQRKKENSLDWEDWQYFARNCG
AFGMKNNGDLEKPDSVNCLQLSNFTPYSRGNVTFSILTPGPNYRPGYNDFYNTPSLQEFV
KATQIRFHFHGQYYTTETAVNLRHRYYAVDEITISGRCQCHGHADNCDTTSQPYRCLCSQ
ESFTEGLHCDRCLPLYNDKPFRQGDQVYAFNCKPCQCNSHSKSCHYNISVDLFPFEHFRG
GGGVCDDCEHNTTGRNCELCKDYFFRQVGADPSAIDVCKPCDCDKVGTGNGSILCDQIGG
QCNCKRHVSGRQCNQCQNGFYNLQELDPDGCSPCNCNTSGTVDGDITCHQNSGQCKCKAN
VIGLRCDRCNFGFKFLRSFNDDGCEPCQCNLHGSVNKFCNPHSGQCECKKEAKGLQCDTC
RENFYGLDVTNCKACDCDTAGSLPGTVCNAKTGQCICKPNVEGRQCNKCLEGNVYLRQNN
SFLCLPCNCDKTGTINGSLLCDKSTGQCPCKLGVTGLRCNQCEPHRYNLTIDNFQHCQMC
ECDSLGTLPGTICDPISGQCLCVPNRQGRRCNQCQPGFYISPGNATGCLPCSCHTTGAVN
HTCNSLTGQCVCQDASIAGQRCDQCRDHYFGFDPQTGRCQPCNCHLSGALNETCHLVTGQ
CFCKQFVTGSKCDACVPSASHLDVNNLLGCSKTPFQQPPPRGQVQSSSAINLSWSPPDSP
NAHWLTYSLLRDGFEIYTTEDQYPYSIQYFLDTDLLPYTKYSYYIETTNAHGSTRSVAVT
YKTKPGVPEGNLTLSYIIPIGSDSVTLTWTTLSNQSGPIEKYILSCAPLAGGQPCVSYEG
HETSATIWNLVPFAKYDFSVQACTSGGCLHSLPITVTTAQAPPQRLSPPKMQKISSTELH
VEWSPPVELNGIIIRYELYMRRLRSTKETTSEESRVFQSSGWLSPHSFVESANENALKPP
QTMATITGLEPYTKYEFRVLAVNMAGSVSSAWVSERTGESAPVFMIPPSVFPLSSYSLNI
SWEKPADNVTRGKVVGYDINMISEQSPQQSIPMAFSQLLHTAKSQELSYTVEGLKPYRIY
EFTITLCNSVGCVTSASGAGQTLAAAPAQLRPPLVKGINSTTIHLRWFPPEELNGPSPIY
QLERRESSLPALMTTMMKGIRFIGNGYCKFPSSTHPVNTDFTGIKASFRTKVPEGLIVFA
ASPGNQEEYFALQLKKGRLYFLFDPQGSPVEVTTTNDHGKQYSDGKWHEIIAIRHQAFGQ
ITLDGIYTGSSAILNGSTVIGDNTGVFLGGLPQSYTILRKDPEIIQKGFVGCLKDVHFMK
NYNPSAIWEPLDWQSSEEQINVYNSWEGCPASLNEGAQFLGAGFLELHPYMFHGGMNFEI
SFKFRTDQLNGLLLFVYNKDGPDFLAMELKSGILTFRLNTSLAFTQVDLLLGLSYCNGKW
NKVIIKKEGSFISASVNGLMKHASESGDQPLVVNSPVYVGGIPQELLNSYQHLCLEQGFG
GCMKDVKFTRGAVVNLASVSSGAVRVNLDGCLSTDSAVNCRGNDSILVYQGKEQSVYEGG
LQPFTEYLYRVIASHEGGSVYSDWSRGRTTGAAPQSVPTPSRVRSLNGYSIEVTWDEPVV
RGVIEKYILKAYSEDSTRPPHMPSASAEFVNTSTLTGILTGLLPFKNYAVTLTACTLAGC
TESSHALNISTPQEAPQEVQPPVAKSLPSSLLLSWNPPKKANGIITQYCLYMDGRLIYSG
SEENYTVTDLAVFTPHQFLLSACTHVGCTNSSWVLLYTAQLPPEHVDSPVLTVLDSRTIY
IQWKQPRKISGILERYVLYMSNHTHDFTIWSVIYNSTELFQDHMLQYVLPGNKYLIKLGA
CTGGGCTVSEASEALTDEDIPEGVPAPKALSYLPDSFNVSWTEPEYPNGVVTSYGLYLDG
ILIHNSSELSYRAYGFAPWSLHSFRVQACTTKGCALGPLVENRTLEAAPEGTVNVFVKTQ
GSRKAHVRWEAPFRPNGLLTYSVLFTGIFYVDPVGNNYTLLNVTKVMYSGEETNLWVLID
GLVPFTNYTVQVNISNSQGSLITDPVTIAMPPGAPDGVLPPRLSSATPTSLQVVWSTPAR
NNAPGFPRYQLQMRSGNSTHGFLELFSNPSASLSYEVSDLQPYTEYMFRLVASNGFGSAH
SSWILFMTAEDKPGPVVPPILLDVKSRMMLVTWQHPRKSNGVITHYNIYLHGRLYLRTPG
NVTNCTVMHLHPYTAYKFQVEACTSKGCSLSPESQTVWTLPGAPEGIPSPELFSDTPTSV
IISWQPPTHPNGLVENFTIERRVKGKEEVTTLVTLPRSHSMRFIDKTSALSPWTKYEYRV
LMSTLHGGTNSSAWVEVTTRPSRPAGVQPPVVTVLEPDAVQVTWKPPLIQNGDILSYEIR
MPDPHITITNVTSAVLSQKVTHLIPFTNYSVTIVACSGGNGYLGGCTESLPTYVTTHPTV
PQNVGPLSVIPLSESYVVISWQPPSKPNGPNLRYELLRRKIQQPLASNPPEDLNRWHNIY
SGTQWFYEDKGLSRFTTYEYMLFVHNSVGFTPSREVTVTTLAGLPERGANLTASVLNHTA
IDVRWAKPTVQDLQGEVEYYTLFWSSATSNDSLKILPDVNSHVIGHLKPNTEYWIFISVF
NGVHIINSAGLHATTCDGEPQGMLPPEVVIINSTAVRVIWTSPSNPNGVVTEYSIYVNNK
LYKTGMNVPGSFILRDLSPFTIYDIQVEVCTIYACVKSNGTQITTVEDTPSDIPTPTIRG
ITSRSLQIDWVSPRKPNGIILGYDLLWKTWYPCTKTQKLVQDHSDELCKAVRCQKPEYIC
GHICYSSEAKVCCNGVLYNPKPGHRCCEEKYIPFVLNSTGVCCGGRIQEAQPNHQCCSGY
YARILPGEVCCPDEQHNRVSVGIGDSCCGRMPYSTSGNQICCAGRLHDGHGQKCCGGQIV
SNDLECCGGEEGVVYNRLPGMFCCGQDYVNMSDTICCSASSGESKAHVKKNDPVPVKCCE
TELIPKSQKCCNGVGYNPLKYVCSDKISTGMMMKETKECRILCPASMEATAHCGRCDFNF
TSHICTVIRGSRNSTGKASIEEMCSSAEETIHTGSVNTYSYTDVNLKPYMTYEYRISAWN
SYGRGLSKAVRARTKEDVPQGVSPPMWTKIDNLEDTIVLNWRKPIQSNGPIIYYILLRNG
IERFRGTSLSFSDKEGIQPFQEYSYQLKACTVAGCATSSKVVAATTQGVPESILPPSITA
LSAVALHLSWSVPEKPNGVIKEYQIRQVGKGLIHTDTTDRRQHTVTGLQPYTNYSFTLTA
CTSAGCTSSKPFLGQTLQAAPEGVWVTPRHIIINSTTVELYWSLPEKPNGLVSQYQLSRN
GNLLFLGGSEEQNFTDKNLEPNSRYTYKLEVKTGGGSSASDDYIVQTPMSTPEEIYPPYN
ITVIGPYSIFVAWIPPGILIPEIPVEYNLLLNDGSVTPLAFSVGHHQSTLLENLTPFTQY
EIRIQACQNGSCGVSSRMFVKTPEAAPMDLNSPVLKALGSACIEIKWMPPEKPNGIIINY
FIYRRPAGIEEESVLFVWSEGALEFMDEGDTLRPFTLYEYRVRACNSKGSVESPWSLTQT
LEAPPQDFPAPWAQATSAHSVLLNWTKPESPNGIISHYRVVYQERPDDPTFNSPTVHAFT
VKGTSHQAHLYGLEPFTTYRIGVVAANHAGEILSPWTLIQTLESSPSGLRNFIVEQKENG
RALLLQWSEPMRTNGVIKTYNIFSDGFLEYSGLNRQFLFRRLDPFTLYTLTLEACTRAGC
AHSAPQPLWTDEAPPDSQLAPTVHSVKSTSVELSWSEPVNPNGKIIRYEVIRRCFEGKAW
GNQTIQADEKIVFTEYNTERNTFMYNDTGLQPWTQCEYKIYTWNSAGHTCSSWNVVRTLQ
APPEGLSPPVISYVSMNPQKLLISWIPPEQSNGIIQSYRLQRNEMLYPFSFDPVTFNYTD
EELLPFSTYSYALQACTSGGCSTSKPTSITTLEAAPSEVSPPDLWAISATQMNVCWSPPT
VQNGKITKYLVRYDNKESLAGQGLCLLVSHLQPYTQYNFSLVACTNGGCTASVSKSAWTM
EALPENMDSPTLQVTGSESIEITWKPPRNPNGQIRSYELRRDGTIVYTGLETRYHDFTLT
PGVEYGYTVTASNSQGGILSPLVKDRTSPSAPSGMEPPKLQARGPQEILVNWDPPVRTNG
DIINYTLFIRELFERETKIIHINTTHNSFGTQSYIVNQLKPFHRYEIRIQACTTLGCASS
DWTFIQTPEIAPLMQPPPHLEVQMAPGGFQPTVSLLWTGPLQPNGKVLYYELYRRQIATQ
PGKSNPVLIYNGSSTSFIDSELLPFTEYEYQVWAVNSAGKAPSSWTWCRTGPAPPEGLRA
PTFHAISSTQAVVNISAPGKPNGIVSLYRLFSSSAHGAETVLSEGMATQQTLHGLQAFTN
YSIGVEACTCFNCCSKGPTAELRTHPAPPSGLSSPQIETLASRTASFRWSPPMFPSGVIH
SYELQLHVACLPDSALPCTPSQIETKYTGLGQKASLGGLQPYTTYKLRVVAHNEVGSTAS
EWISFTTQKELPQYRAPFSVDSNLSVVCVNWSDTFLLNGQLKEYVLTDGGRRVYSGFDTT
LYIPRTADKTFFFQVICTTDEGSVKTPLIQYDTSTGLGLVLTTPGEKKGSRSKSTEFYSE
LWFIVLMAMLGLILLAIFVSLTLQRKIHKEPYIRERPPLVPLQKRMSPLNVYPPGENHMF
DSVADISDVSSNVKLKSYTMHFGLADTKIPRSGTPVSIRSNRSACVLRIPSQSQTSLTYT
QGSLHRSVSQLMDIQDKKVLMDNSLWEAVMGHSSGLYVDEEDLMNAIKGFSSVTKERTTF
TDTHL
Download sequence
Identical sequences ENSPTRP00000057764 ENSPTRP00000057764 9598.ENSPTRP00000057764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]