SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000057841 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000057841
Domain Number 1 Region: 90-144
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000269
Family V set domains (antibody variable domain-like) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000057841   Gene: ENSPTRG00000002605   Transcript: ENSPTRT00000066265
Sequence length 307
Comment pep:known_by_projection chromosome:CHIMP2.1.4:10:70280346:70303315:-1 gene:ENSPTRG00000002605 transcript:ENSPTRT00000066265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASPRRPRPARSPAPEVPLRVRRRHGRPHGPGGRQLALGIPALRSLPGCVPRLLGPVDKGH
DVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASD
HHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSS
SQESENITAAALATGACIVGILCLPLILLLVYKQRQAASNRLAPELLAQDSNIQGIENPG
FEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPD
SPNFEVI
Download sequence
Identical sequences ENSPTRP00000057841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]