SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000057846 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000057846
Domain Number 1 Region: 22-117
Classification Level Classification E-value
Superfamily Immunoglobulin 1.17e-22
Family C1 set domains (antibody constant domain-like) 0.00000344
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000057846   Gene: ENSPTRG00000007020   Transcript: ENSPTRT00000066271
Sequence length 119
Comment pep:known chromosome:CHIMP2.1.4:15:41840131:41844441:1 gene:ENSPTRG00000007020 transcript:ENSPTRT00000066271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLL
KNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWERSM
Download sequence
Identical sequences ENSPTRP00000057846 ENSPTRP00000057846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]