SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000057950 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000057950
Domain Number 1 Region: 3-147
Classification Level Classification E-value
Superfamily Globin-like 6.51e-56
Family Globins 0.000000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000057950   Gene: ENSPTRG00000028731   Transcript: ENSPTRT00000066372
Sequence length 147
Comment pep:known chromosome:CHIMP2.1.4:11:5005050:5006582:-1 gene:ENSPTRG00000028731 transcript:ENSPTRT00000066372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPK
VKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFRLLGNVLVTVLAIHFG
KEFTPEVQASWQKMVTAVASALSSRYH
Download sequence
Identical sequences H2R5L8 Q28779
ENSPTRP00000048282 ENSPTRP00000048283 ENSPTRP00000057950 XP_016775391.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]