SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000058110 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000058110
Domain Number 1 Region: 30-351
Classification Level Classification E-value
Superfamily ARM repeat 7.28e-53
Family Armadillo repeat 0.023
Further Details:      
 
Domain Number 2 Region: 350-545
Classification Level Classification E-value
Superfamily ARM repeat 5.66e-33
Family Armadillo repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000058110   Gene: ENSPTRG00000002356   Transcript: ENSPTRT00000066531
Sequence length 643
Comment pep:known_by_projection chromosome:CHIMP2.1.4:10:23280619:23358855:1 gene:ENSPTRG00000002356 transcript:ENSPTRT00000066531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKKIKKEVEPPPKDVFDPLIIESKKAATVVLMLNSPEEEILAKACEAIYKFALKGEENK
TTLLELGAVEPLTKLLTHEDKIVRRNATMIFGILASNNDVKKLLRELDVMNSVIAQLAPE
EEVVIHEFASLCLANMSAEYTSKVQIFEHGGLEPLIRLLSSPDPDVKKNSMECIYNLVQD
FQCRAKLQELNAIPPILDLLKSEYPVIQLLALKTLGVITNDKESRIMLRDNQGLDHLIKI
LETKELNDLHIEALAVIANCLEDMDTVVQIQQTGGLKKLLSFAENSTIPDIQKNAAKAIT
KAAYDPENRKLFHEQEVEKCLVALLGSENDGTKIAASQAISAMCENSGSKDFFNNQGIPQ
LIQLLKSDNEEVWEAAALALAHLTTCNPANANAAAEADGIDPLINVLSSKRDGAIANAAT
VLTNMAMQEPLRLNIQNHDIMHAIISPLRSANTVVQSKAALAVTATACDVEARTELRNSG
GLEPLVELLRSKNDEVRKHASWAVMVCAGDELTANELCRLGALDILEEVNVSGTRKNKFS
EAAYNKLLNNNLSLKYSQTGYLSSSNIINDGFYDYGRINPGTKLLPLKELCLQEPSDLRA
VLLINSKSYVSPPSSMEDKSDVGYGRSISSSSSLRRSSKEKNK
Download sequence
Identical sequences ENSPTRP00000058110 ENSPTRP00000058110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]