SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000058400 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000058400
Domain Number 1 Region: 519-683
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000119
Family SPRY domain 0.029
Further Details:      
 
Domain Number 2 Region: 50-210
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000127
Family SPRY domain 0.088
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000058400
Domain Number - Region: 724-883
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00791
Family SPRY domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000058400   Gene: ENSPTRG00000033982   Transcript: ENSPTRT00000066824
Sequence length 1559
Comment pep:novel chromosome:CHIMP2.1.4:17:7376607:7390122:-1 gene:ENSPTRG00000033982 transcript:ENSPTRT00000066824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGSGGSGGSGGGPGPGPGGGGGPSGSGSGPGSNGGLGSGGELHPRTGRLVSLSACGRT
ARRQQPGQEFNHGLVLSREPLRDGRVFTVRIDRKVNSWSGSIEIGVTALDPSVLDFPSSA
TGLKGGSWVVSGCSVLRDGRSVLEEYGQDLDQLGEGDRVGVERTVAGELRLWVNGRDCGV
AATGLPPRVWAVVDLYGKCTQITVLTPEPGFSPPTPIPTPPLEPLAPTEDSALAEQGTSA
DEAFTVSPAQARPETFPNSLESHNDFANMELSEVVSNTILSAYNGGLLNVNLSSPPAGEG
LGSSGAATSPILTSNDALLFHEKCGTLIKLSNNNKTAERRRPLDEFNNGVVMTNRPLRDN
EMFEIRIDKLVDKWSGSIEIGVTTHNPNSLEYPATMTNLQSGTIMMSGCGILTNGKGTRR
EYCEFSLDELQEGDHIGLTRKSNSALHFFINGIDQGVATPLTPPVVYGVVDLYGMAVKVT
IVHNNNHSDRLRRNNAILRALSPEGALRRAAPAAQAEPERLLFHPNCGQKAAITHEGRTA
LRPHATDDFNHGVVLSSRALRDGEVFQVRIDKMVDKWAGSIEIGVTTHNPAYLQLPSTMT
NLRSGTWMMTGNGVMHNGTTILDEYGHNLDRLKAGDTVGVVRREDGTLHFFVNGMTQGPA
AWNVPPGVYAVVDLYGQAAQATIVDDVEVVPVPEPLPEGNNQVSPSSPSSGAGGSDLRFH
QLHGSNAVITNGGRTALRHNCRSEFNDAIVISNRALRDGELFEIVIQKMVDRWSGSIEAG
VTAIRPEDLEFPNTMTDIDYDTWMLSGTAIMQDGNTMRNNYGCDLDALGTGARIGMMRTA
KGDLHYFINGQDQGAACSGLPPGKEVYAVVDLYGQCVQVSITNATGPMDNSLATSNTATE
KSFPLHSPVAGVAHRFHSTCGKNVTLEEDGTRAVRAAGYAHGLVFSTKELRADEVFEVKV
EELDEKWAGSLRLGLTTLAPGEMGPGAGGGGPGLPPSLPELRTKTTWMVSSCEVRRDGQL
QRMNYGRNLERLGVGSRVGVRRGADDTMHILVDGEDMGPAATGIAKNVWAVLDLYGPVRG
VSIVSSTRLEESEGTQPPSPSSDTGSEGEEDDEGEEHGLGGQNEVGIIPTTLEFLENHGK
NILLSNGNRTATRVASYNQGIVVINQPLVPQLLVQVRIDFLNRQWTSSLVLGVITCAPER
LNFPASACALKRAAWLLRGRGVFHNGLKICEXXXXNLDTCHEGTIKGMRDKRGMHLQNGV
NPEVDVLDVPQPCYALVDLYGQCEQVTIVNPEPGAASGKSAGTQGDMEKADMVDGIKESV
CWGPPPAASPLKSCEYHALCSRFQELLLLPEDYFMPPPKRSLCYCESCRKLRGDEAHRRR
GEPPREYALPFGWCRFNLRVNPRLEAGTLTKKWHMAYHGSNVAAVRRVLDRGELGAGTAS
ILSCRPLKGEPGVGFEEPGENCAPPREEQPPPVLLSPSLQYAGAETLASKVQFRDPKSQR
THQAQVAFQVCVRPGSYTPGPPSAALGEPPDPHFSPAELEWVTKEKGATLLCALLVRVE
Download sequence
Identical sequences ENSPTRP00000058400 ENSPTRP00000058400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]