SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000058566 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000058566
Domain Number 1 Region: 30-254
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.81e-66
Family Lectin leg-like 0.00000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000058566   Gene: ENSPTRG00000007283   Transcript: ENSPTRT00000066987
Sequence length 526
Comment pep:known_by_projection chromosome:CHIMP2.1.4:15:72380616:72393865:1 gene:ENSPTRG00000007283 transcript:ENSPTRT00000066987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAVSGPGPLFCLLLLLLDPHSPETGCPPLRRFEYKLSFKGPRLALPGAGIPFWSHHGDA
ILGLEEVRLTPSMRNRSGAVWSRASVPFSAWEVEVQMRVTGLGRRGAQGMALWYTRGRGH
VGSVLGGLASWDGIGIFFDSLAEDTQDSPAIRVLASDGHIPSEQPGDGASQVLGSCHWDF
RNRPHPFRARITYWGQRLRVSLNSGLTHSDPDEFCVDVGPLLLVPGGFFGVSAATGTLAD
DHDVLSFLTFSLSEPSPEVPPQPFLEMQQLRLARQLEGLRARLGLGTREDVTPKSDSEAQ
GEGERLFDLEETLGRHRGILQALWGLSKQLAQAERQWKKQLGPLGQARPDGGWALDASCQ
IPSTPGRGGHLSMSLNKDSAKVGALLHGQWTLLQALQEMRDAAVRMAAEAQVSYLPVGTE
HHFLELDHILGLLQEELRGPAKAVAKAPRPPGQPPRASSCLQPGIFLFYLLIQTVGFFGY
VHFRQELNKSLQECLSTGSLPLDPAPHTPRAPGILRGPPLPASMPA
Download sequence
Identical sequences H2RDB7
ENSPTRP00000058566 ENSPTRP00000058566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]