SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000058864 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000058864
Domain Number 1 Region: 209-246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000161
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 2 Region: 88-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000117
Family EGF-type module 0.014
Further Details:      
 
Domain Number 3 Region: 171-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000171
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 131-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000544
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000058864
Domain Number - Region: 65-87
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0146
Family EGF-type module 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000058864   Gene: ENSPTRG00000006726   Transcript: ENSPTRT00000067277
Sequence length 383
Comment pep:known_by_projection chromosome:CHIMP2.1.4:14:100417210:100425460:1 gene:ENSPTRG00000006726 transcript:ENSPTRT00000067277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTATEALLRVLLLLLAFGHSTYGAECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTS
PGCLHGLCEEPGQCICTDGWDGELCDRDVRACSSTPCANNGTCVSLDDGLYECSCAPGYS
GKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCE
NDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFT
GLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLT
EGQAICFTILGVLTSLVVLGTVGIVFLNKCETWVSNLRYNHMLRKKKNLLLQYNSGEDLA
VNIIFPEKIDMTTFSKEAGDEEI
Download sequence
Identical sequences H2RDH4
XP_009426750.1.37143 9598.ENSPTRP00000058864 ENSPTRP00000058864 ENSPTRP00000058864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]