SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000058951 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000058951
Domain Number 1 Region: 121-219
Classification Level Classification E-value
Superfamily Immunoglobulin 2.87e-25
Family I set domains 0.00000438
Further Details:      
 
Domain Number 2 Region: 27-119
Classification Level Classification E-value
Superfamily Immunoglobulin 5.65e-24
Family I set domains 0.0022
Further Details:      
 
Domain Number 3 Region: 221-317
Classification Level Classification E-value
Superfamily Immunoglobulin 1.17e-22
Family I set domains 0.00000526
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000058951   Gene: ENSPTRG00000028885   Transcript: ENSPTRT00000067362
Sequence length 444
Comment pep:known chromosome:CHIMP2.1.4:19:59656992:59733035:1 gene:ENSPTRG00000028885 transcript:ENSPTRT00000067362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLMVVSMACVGFFLLQGAWPHMGGQDKPFLSAWPSAVVSEGEYVTLQCRSRLGFNEFSL
SKEDGMPVPELYNRVFRNSLFMGPVTPAHAGTYRCRGSHPHFLTGWSAPSNPLVIMVTGV
HRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANF
PIGRMTQDLAGTYRCYGSLTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTILAGENV
TLSCSSRRSYDMYRLSREGESHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFGYFRDS
PYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNSRHLHVLIGTSAVIILLILLLFFLL
HRWCSKKKNAAVMDQEPAGNRIVKREDSDEQDPQEVTYAQLNHCVFTQRKISPPSERPKT
PPTDTSVYTELPNAEPRSKVVSCP
Download sequence
Identical sequences ENSPTRP00000048486 ENSPTRP00000058951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]