SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000059022 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000059022
Domain Number 1 Region: 1577-1819
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.1e-53
Family Ankyrin repeat 0.000000927
Further Details:      
 
Domain Number 2 Region: 476-592
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000149
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 925-1049
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000659
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 587-624
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000109
Family EGF-type module 0.013
Further Details:      
 
Domain Number 5 Region: 275-317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000109
Family EGF-type module 0.017
Further Details:      
 
Domain Number 6 Region: 766-804
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000187
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 7 Region: 356-478
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000204
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 8 Region: 192-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000547
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 156-199
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000162
Family EGF-type module 0.011
Further Details:      
 
Domain Number 10 Region: 1045-1089
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000073
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 676-808
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000173
Family Growth factor receptor domain 0.0039
Further Details:      
 
Domain Number 12 Region: 1251-1282
Classification Level Classification E-value
Superfamily Notch domain 0.000000196
Family Notch domain 0.0025
Further Details:      
 
Domain Number 13 Region: 234-278
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000255
Family EGF-type module 0.025
Further Details:      
 
Domain Number 14 Region: 808-932
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000267
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 15 Region: 312-357
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000138
Family EGF-type module 0.01
Further Details:      
 
Domain Number 16 Region: 64-115
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000435
Family EGF-type module 0.013
Further Details:      
 
Domain Number 17 Region: 29-62
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000616
Family EGF-type module 0.027
Further Details:      
 
Domain Number 18 Region: 1214-1244
Classification Level Classification E-value
Superfamily Notch domain 0.0000114
Family Notch domain 0.0065
Further Details:      
 
Domain Number 19 Region: 118-154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000248
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000059022
Domain Number - Region: 1173-1202
Classification Level Classification E-value
Superfamily Notch domain 0.00314
Family Notch domain 0.0034
Further Details:      
 
Domain Number - Region: 1087-1124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00327
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 1132-1170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00599
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 624-655
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0145
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000059022   Gene: ENSPTRG00000034379   Transcript: ENSPTRT00000067434
Sequence length 2006
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:32462535:32492701:-1 gene:ENSPTRG00000034379 transcript:ENSPTRT00000067434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPSLLLLLLLLLCVSVVIPRGLLCGSFPEPCANGGTCLSLPLGQGTCQCAPGFLGETC
QFPDPCQNAQLCQNGGSCQALLPAPLGLPSSPSPLTPSFLCTCLPGFTGERCQAQLEDPC
PPSFCSKRGRCHIQASGRPQCSCMPGWTGEQCQLRDFCSANPCVNGGVCLATYPQIQCHC
PPGFEGHACERDVNECFQDPGPCPKGTSCHNTLGSFQCLCPVGQEGPRCELRAGPCPPRG
CSNGGTCQLMPGKDSTFHLCLCPPGFLGLDCEVNPDNCVSHQCQNGGTCQDGLDTYTCLC
PETWTGWDCSEDVDECETQGPPHCRNGGTCQNSAGSFHCVCVSGWGGTSCEENLDDCIAA
TCAPGSTCIDRVGSFSCLCPPGRTGLLCHLKDMCLSQPCHGDAQCSTNPLTGSTLCLCQP
GYSGPTCHQDLDECLMAQQGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLSQ
PCHPGSTCLDLLATFHCLCPPGLEGQLCEVETNECASAPCLNHADCHDLLNGFQCICLPG
FSGTRCEEDIDECRSFPCANGGQCQDQPGAFHCKCLPGFEGPRCQTEVDECLSDPCPVGA
SCLDLPGAFFCLCPSGFTGQLCEVPLCAPNLCQPKQICKDQKDKANCLCPDGSPGCAPPE
DNCTCHHGHCQRSSCVCDVGWTGPECEAELGGCISAPCAHGGTCYPQPSGYNCTCPTGYT
GPTCSEEMTACHSGPCLNGGSCNPSPGGYYCTCPPSHTGPQCQTSTDYCVSAPCFNGGTC
VNRPGTFSCLCAMGFQGPRCEGKIRPSCADSPCRNRATCQDSPQGPRCLCPTGYTGGSCQ
TLMDLCAQKPCPSNSHCLQTGPSFHCLCLQGWTGPLCNLPLSSCQKAALSQGIDVSSLCH
NGGLCVDSGPSYFCHCPPGFQGSLCQDHVNPCESRPCQNGATCMAQPSGYLCQCAPGYDG
QNCSKELDACQSQPCHNHGTCTPKPGGFHCACPPGFVGLRCEGDVDECLDQPCHPTGTAA
CHSLANAFYCQCLPGHTGQWCEVEIDPCHSQPCFHGGTCEATAGSPLGFICHCPKGFEGP
TCSHRAPSCGFHHCHHGGLCLPSPKPGFPPRCACLSGYGGPDCLTPPAPKGCGPPSPCLY
NGSCSETTGLGGPGFRCSCPHSSPGPRCQKPGAKGCEGRSGDGACDAGCSGPGGNWDGGD
CSLGVPDPWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCETPPACTPAYDQYCHDH
FHNGHCEKGCNTAECGWDGGDCRPEDGDPEWGPSLALLVVLSPPALDQQLFALARVLSLT
LRVGLWVRKDRDGRDMVYPYPGARAEEKLGGTRDPTYQERAAPQTQPLGKETDSLSAGFV
VVMGVDLSRCGPDHPASRCPWDPGLLLRFLAAMAAVGALEPLLPGPLLAVHPHAGTAPPA
NQLPWPVLCSPVAGVILLALGALLVLQLIRRRRREHGALWLPPGFTRRPRTQSAPHRRRP
PLGEDSIGLKALKPKAEVDEDGVVMCSGPEEGEEVGQAEETGPPSTCQLWSLSGGCGALP
QAAMLTPPQESEMEAPDLDTRGPDGVTPLMSAVCCGEVQSGTFQGAWLGCPEPWEPLLDG
GACPQAHTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHAAVAADAREV
CQLLLRSRQTAVDARTEDGTTPLMLAARLAVEDLVEELIAAQADVGARDKWGKTALHWAA
AVNNARAARSLLQAGADKDAQDNREQTPLFLAAREGAVEVAQLLLGLGAARELRDQAGLA
PADVAHQRNHWDLLTLLEGAGPPEARHKATPGREAGPFPRARTVSVSVPPHGGGALPRCR
TLSAGAGPRGGGACLQARTWSVDLAARGGGAYSHCRSLSGVGAGGGPPPRGRRFSAGMRG
PRPNPAIMRGRYGVAAGRGGRVSTDDWPCDWVALGACGSASNIPIPPPCLTPSPERGSPQ
LDCGSPALQEMPINQGGEGKKSKNTW
Download sequence
Identical sequences ENSPTRP00000059022 ENSPTRP00000059022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]