SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000059162 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000059162
Domain Number 1 Region: 290-404
Classification Level Classification E-value
Superfamily Cyclin-like 2.98e-27
Family Cyclin 0.001
Further Details:      
 
Domain Number 2 Region: 407-530
Classification Level Classification E-value
Superfamily Cyclin-like 9.46e-27
Family Cyclin 0.0037
Further Details:      
 
Domain Number 3 Region: 32-114
Classification Level Classification E-value
Superfamily F-box domain 0.00000000157
Family F-box domain 0.0062
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000059162
Domain Number - Region: 89-134,182-226
Classification Level Classification E-value
Superfamily HCP-like 0.0105
Family HCP-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000059162   Gene: ENSPTRG00000007649   Transcript: ENSPTRT00000067576
Sequence length 786
Comment pep:known chromosome:CHIMP2.1.4:16:2493502:2524426:1 gene:ENSPTRG00000007649 transcript:ENSPTRT00000067576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGGVVHCRCAKCFCYPTKRRIRRRPRNLTILSLPEDVLFHILKWLSVEDILAVRAVHS
QLKDLVDNHASVWACASFQELWPSPGNLKLFERAAEKGNFEAAVKLGIAYLYNEGLSVSD
EARAEVNGLKASRFFSLAERLNVGAAPFIWLFIRPPWSVSGSCCKAVVHESLRAECQLQR
THKASILHCLGRVLSLFEDEEKQQQAHDLFEEAAHQGCLTSSYLLWESDRRTDVSDPGRC
LHSFRKLRDYAAKGCWEAQLSLAKACANANQLGLEVRASSEIVCQLFQASQAVSKQQVFS
VQKGLNDTMRYILIDWLVEVATMKDFTSLCLHLTVECVDRYLRRRLVPRYRLQLLGIACM
VICTRFISKEILTIREAVWLTDNTYKYEDLVRMMGEIVSALEGKIRVPTVVDYKEVLLTL
VPVELRTQHLCSFLCELSLLHTSLSAYAPARLAAAALLLARLTHGQTQPWTTQLWDLTGF
SYEDLIPCVLSLHKKCFHDDAPKDYRQVSLTAVKQRFEDKRYGEISQEEVLSYSQLCAAL
GVTQDSPDPPTFLSTGEIHAFLSSPSGRRTKRKRENSLQEDRGSFVTTPTAELSSQEETL
LGSFLDWSLDCCSGYEGDQESEGEKEGDVTAPSGILDVTVVYLNPEQHCCQESSDEEACP
EDKGPQDPQALALDTQIPATPGPKPLVRTSREPGKDVTTSGYSSVSTASPTSSVDGGLGA
LPRPTSVLSLDSDSHTQPCHHQARKSCLQCRPPSPPESSVPQQQVKRINLCIHSEEEDMN
LGLVRL
Download sequence
Identical sequences H2RDP3
ENSPTRP00000059162 9598.ENSPTRP00000013073 ENSPTRP00000059162 XP_510746.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]