SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000059190 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000059190
Domain Number 1 Region: 20-283
Classification Level Classification E-value
Superfamily L domain-like 5.35e-49
Family Ngr ectodomain-like 0.017
Further Details:      
 
Domain Number 2 Region: 279-372
Classification Level Classification E-value
Superfamily Immunoglobulin 7.38e-20
Family I set domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000059190   Gene: ENSPTRG00000003941   Transcript: ENSPTRT00000067605
Sequence length 478
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:64820755:64823754:1 gene:ENSPTRG00000003941 transcript:ENSPTRT00000067605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPLLLLLLASGAAACPLPCVCQNLSESLSTLCAHRGLLFVPPNVDRRTVELRLADNFI
QALGPPDFRNMTGLVDLTLSRNAITRIGARAFGDLESLRSLHLDGNRLVELGTGSLRGPV
NLQHLILSGNQLGRIAPGAFDDFLESLEDLDLSYNNLRQVPWAGIGAMPALHTLNLDHNL
IDALPPGAFAQLGQLSRLDLTSNRLATLAPDPLFSRGRDAEASPAPLVLSFSGNPLHCNC
ELLWLRRLARPDDLETCASPPGLAGRYFWAVPEGEFSCEPPLIARHTQRLWVLEGQRATL
RCRALGDPAPTMHWVGPDDRLVGNSSRARAFPNGTLEIGVTGAGDAGGYTCIATNPAGEA
TARVELRVLALPHGGNSSAEGGRPGPSDIAASARTAAEGEGTLESEPAVQVTEVTATSGL
VSWGPGRPADPVWMFQIQGPGAAWPGSPSLVFILGTSGSPVYLAGQGALSSVLASRPG
Download sequence
Identical sequences ENSPTRP00000059190 ENSPTRP00000059190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]