SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000059776 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000059776
Domain Number 1 Region: 88-272
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.24e-61
Family SPRY domain 0.0000000112
Further Details:      
 
Domain Number 2 Region: 3-76
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000919
Family RING finger domain, C3HC4 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000059776   Gene: ENSPTRG00000041470   Transcript: ENSPTRT00000072947
Sequence length 287
Comment pep:novel chromosome:CHIMP2.1.4:19:60750390:60751763:1 gene:ENSPTRG00000041470 transcript:ENSPTRT00000072947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEHFKQVIRCPVCLKDLEEAVQLKCGYACCLQCLNSLQKEPDGEGLLCRFCSVVSQKDD
IKPKYKLRALVSIIKELEPKLKKVLTMNPRMRKFQVDMTLDVDTANNYLIISEDLRSFRS
GDLSQNRKEQAERFDTALCVLGTPRFTSGRHYWEVDVGTSQVWDVGVCKESVNRQGKIVL
SSEHGFLTVGCREGKVFAASSVPMTPLWVSPQLHRVGIFLDVGMRSIAFYNVSDGCHIYT
FIEIPVCEPWRPFFAHQRGSQDDQSILSICSVINPATASAPVSSGGK
Download sequence
Identical sequences ENSPTRP00000059776 ENSPTRP00000059776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]