SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000059799 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000059799
Domain Number 1 Region: 202-373
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.41e-43
Family SPRY domain 0.00021
Further Details:      
 
Domain Number 2 Region: 5-80
Classification Level Classification E-value
Superfamily RING/U-box 5.05e-16
Family RING finger domain, C3HC4 0.027
Further Details:      
 
Domain Number 3 Region: 85-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000336
Family B-box zinc-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000059799   Gene: ENSPTRG00000004161   Transcript: ENSPTRT00000074316
Sequence length 375
Comment pep:novel scaffold:CHIMP2.1.4:GL391857.1:29718:40644:1 gene:ENSPTRG00000004161 transcript:ENSPTRT00000074316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSGILQVFQRELICPMCMNYFIDPVTIDCGHSFCRPCFYLNWQDIPFLVHCSECTKSAE
QINLKTNIHLKKMASLARKVSLWLFLSSEEQMCGIHRETKKIFCEVDRSLLCLLCSSSQE
HRYHRHRPIEWAAEEHREKLLQKMQSLWEKACENHRNLNVETTRTRCWKVSPVFPCRSES
VLLHMPQPLNPELSAGPITGLRDRLNQFRVHITLHHEEANSDTFLYEILRSMCIGCDHQD
VPYFTATPRSFLAWGAQTFTSGKYYWEVHVGDSWNWAFGVCNMYWKEKNQNEKIDGEKGL
FLLGCVKNDIQCSLFTTSPLMLQYIPKPTSRVGLFLDCEAKTVSFVDVNQSSLIYTIPNC
SFSPPLRPIFCCIHF
Download sequence
Identical sequences ENSPTRP00000059799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]