SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Pan troglodytes 76_2.1.4 > ENSPTRP00000059846

Domain assignment for ENSPTRP00000059846 from Pan troglodytes 76_2.1.4

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSPTRP00000059846
Domain Number 1	Region: 56-88
Classification Level	Classification	E-value
Superfamily	CCCH zinc finger	0.000000000114
Family	CCCH zinc finger	0.00024
Further Details:

Domain Number 2	Region: 28-51
Classification Level	Classification	E-value
Superfamily	CCCH zinc finger	0.00000392
Family	CCCH zinc finger	0.001
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSPTRP00000059846 Gene: ENSPTRG00000030712 Transcript: ENSPTRT00000076313
Sequence length	243
Comment	pep:known_by_projection chromosome:CHIMP2.1.4:14:67952950:67955947:-1 gene:ENSPTRG00000030712 transcript:ENSPTRT00000076313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MTTTLVSATIFDLSEVLCKRLLPTKQPFEENGACKYGDKCQFAHGIHELRSLTRHPKYKT ELCRTFHTIGFCPYGPRCHFIHNAEERRALAGARDLSADRPRLQHSFSFAGFPSAAATAA ATGLLDSPTSITPPPILSADDLLGSPTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPT TFLFRPMSESPHMFDSPPSPQDSLSDQEGYLSSSSSSHSGSDSPTLDNSRRLPIFSRLSI SDD
Download sequence
Identical sequences	ENSPTRP00000059846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]