SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000059888 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000059888
Domain Number - Region: 15-52
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0281
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000059888   Gene: ENSPTRG00000041925   Transcript: ENSPTRT00000074216
Sequence length 94
Comment pep:known_by_projection chromosome:CHIMP2.1.4:7:101614686:101619482:1 gene:ENSPTRG00000041925 transcript:ENSPTRT00000074216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CVNKCTKGTKSQMNCNLGTCQLQRSGPRCLCPNTNTHWYWGETCEFNIAKSLVYGIVGAV
MAVLLLTLIILIILFSLSQRKRHRPESEGEQIRP
Download sequence
Identical sequences A0A2J8Q8S3
ENSPTRP00000059888 ENSPTRP00000059888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]