SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000059891 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000059891
Domain Number 1 Region: 1-143
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.71e-34
Family Cold shock DNA-binding domain-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000059891   Gene: ENSPTRG00000042604   Transcript: ENSPTRT00000073152
Sequence length 166
Comment pep:known chromosome:CHIMP2.1.4:11:63956496:63958288:-1 gene:ENSPTRG00000042604 transcript:ENSPTRT00000073152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQATKRKHVVKEVLGEHIVPSDQQQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKN
IWIKRGDFLIVDPIEEGEKVKAEISFVLCKDHVRSLQKEGFWPEAFSEVAEKHNNNRNRQ
TQPELPAEPQLSGEESSSEDDSDLFVNTNRRQYHESEEESEEEEAA
Download sequence
Identical sequences H2REF5
9598.ENSPTRP00000006736 ENSPTRP00000059891 XP_003828701.1.60992 XP_008952344.1.60992 XP_008952345.1.60992 XP_008952346.1.60992 XP_008952347.1.60992 XP_014202374.1.60992 XP_016776763.1.37143 XP_016776764.1.37143 XP_016776765.1.37143 XP_016776766.1.37143 XP_016776767.1.37143 XP_016776768.1.37143 ENSPTRP00000059891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]