SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000059913 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000059913
Domain Number 1 Region: 33-168
Classification Level Classification E-value
Superfamily Subtilisin-like 6.15e-29
Family Subtilases 0.00000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000059913   Gene: ENSPTRG00000010204   Transcript: ENSPTRT00000074662
Sequence length 196
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:1436582:1444362:-1 gene:ENSPTRG00000010204 transcript:ENSPTRT00000074662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRRTTRTSGPTTTPWPAMTSMTTTRTPSPATPPAKRTGVRMLDGTITDVIEAQSLSLQ
PQHIHIYSASWGPEDDGRTVDGPGILTREAFRRGVTKGRGGLGTLFIWASGNGGLHYDNC
NCDGYTNSIHTLSVGSTTQQGRVPWYSEACASTLTTTYSSGVATDPQIGHDSAAYRPPGD
QQLVCAAGHRGAVPGV
Download sequence
Identical sequences ENSPTRP00000059913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]