SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060053 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000060053
Domain Number 1 Region: 84-159
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 3.92e-31
Family Skp1 dimerisation domain-like 0.0000081
Further Details:      
 
Domain Number 2 Region: 4-69
Classification Level Classification E-value
Superfamily POZ domain 1.62e-22
Family BTB/POZ domain 0.0000538
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060053   Gene: ENSPTRG00000040682   Transcript: ENSPTRT00000074717
Sequence length 162
Comment pep:known chromosome:CHIMP2.1.4:7:64914878:64915363:-1 gene:ENSPTRG00000040682 transcript:ENSPTRT00000074717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSIQLQSFDGEIFAVDVEIAKQSVTIKTTLEDLGMDDEGDDPVPLPNVNAAVLKKVIQW
CTHHKDDPPPPEDDENKEKQTDDIPVWDQEFLKVAQGTLFELILAANYLDIKGLLDVTCK
TVANMIKGKTPEEIRKTFNIKNDLTEEEEAQVRKENQWCEEK
Download sequence
Identical sequences ENSPTRP00000060053 PGOCHP00000178037 ENSPTRP00000060053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]