SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060126 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000060126
Domain Number 1 Region: 53-114
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000000485
Family Ngr ectodomain-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060126   Gene: ENSPTRG00000041466   Transcript: ENSPTRT00000074625
Sequence length 177
Comment pep:known_by_projection chromosome:CHIMP2.1.4:3:132480554:132482165:1 gene:ENSPTRG00000041466 transcript:ENSPTRT00000074625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAWGALLLLWATAEATKDCPSPCTCRALETMGLWVDCRGHGLTALPALPARTRHLLLAN
NSLQSVPPGAFDHLPQLQTLDVTQNPWHCDCSLTYLRLWLEDRTPEALLQVRCASPSLAA
HGPLGRLTGYQLGSCGWQLQASWVRPGVLWDIALVTVAALGLALLAGLLCATTEALD
Download sequence
Identical sequences H2RF34
ENSPTRP00000060126 ENSPTRP00000060126 XP_001140600.1.37143 XP_016797357.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]