SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060321 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000060321
Domain Number 1 Region: 416-748
Classification Level Classification E-value
Superfamily L domain-like 5.44e-63
Family Internalin LRR domain 0.0058
Further Details:      
 
Domain Number 2 Region: 145-451
Classification Level Classification E-value
Superfamily L domain-like 7.48e-56
Family Leucine rich effector protein YopM 0.026
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000060321
Domain Number - Region: 758-850
Classification Level Classification E-value
Superfamily DEATH domain 0.000194
Family DEATH domain, DD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060321   Gene: ENSPTRG00000041391   Transcript: ENSPTRT00000074891
Sequence length 860
Comment pep:known_by_projection chromosome:CHIMP2.1.4:7:92671184:92691590:-1 gene:ENSPTRG00000041391 transcript:ENSPTRT00000074891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEKEGMSEELEDTISQFRKESRSRSMKEPGFIKETSNLINEASDYLEGKSFNQIYETHP
RQNTLESTSSSGRKSKRNEEQKKNLQFSETSTRTGTSQSLSSLTGRTAEYQALVNFLPHE
TVGEVSPQVSEENQKQLGLGEDNFTVNLEAKGLQEFPKDILKIKYVKYLYLDKNQIKTFQ
GADSGDLLGLEILSLQENGLSSLPSEIQLLHNLRILNVSHNHISHIPKEISQLGNIRQLF
FYNNYIENFPTDLECLGNLEILSLGKNKLRHIPDTLPSLKNLRVLNLEYNQLTIFPKALC
FLPKLISLDLTGNLISSLPKEIRELKNLETLLMDHNKLTFLAVEIFQLLKIKELQLADNK
LEVISHKIENFRELRILILDKNLLKNIPEKISCCAMLECLSLSDNKLTELPKYIHKLNNL
RKLHVNRNNMVKITDSISHLNNICSLEFSGNIITDVPIEIKNCQKIIKIELSYNKIMYFP
LGLCALDSLYYLSVNGNYISEIPVDISFSKQLLHLELSENKLLIFSEHFCSLINLKYLDL
GKNQIKKIPASISNMISLHVLILCCNKFETFPRELCTLENLQVLDLSENQLQKISSDICN
LKGIQKLNLSSNQFIHFPIELCQLQSLEQLNISQIKGRKLTRLPGELSNMTQLKELDISN
NAIREIPRNIGELRNLVSLHAYNNQISYLPPSLLSLNDLQQLNLSGNNLTALPSAIYNLF
SLKEINFDDNPLLRPPMEICKGKQLYTIARYLQRADERDEKILEKIFKIVANNITETNFE
FLCQKLNLANSETDMPTKSTVSLSERAHQALVIWKTQSNKLSLTAAALRDQLIRALTMIG
AYEIMDKITALNLFTRAIKF
Download sequence
Identical sequences H2RFM8
XP_016800622.1.37143 XP_016813227.1.37143 XP_016813228.1.37143 XP_527815.1.37143 ENSPTRP00000060321 ENSPTRP00000060321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]