SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060538 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000060538
Domain Number 1 Region: 3-120
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000317
Family Ngr ectodomain-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060538   Gene: ENSPTRG00000041462   Transcript: ENSPTRT00000076187
Sequence length 138
Comment pep:novel chromosome:CHIMP2.1.4:X:154183484:154184498:1 gene:ENSPTRG00000041462 transcript:ENSPTRT00000076187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DHIERIPGYAFAHMKPGLEFLHLSHTRLQADGIHSVSFLGLRASLAELLLDHTRVQAIPR
GLLGLKGLQVLGLSHNRIRQVPLNSICDTRVAQDSNLISTHLENNLFDRRRIPPTAFSCI
RAYHSVVLQPQRGEEEGS
Download sequence
Identical sequences ENSPTRP00000060538 ENSPTRP00000060538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]