SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060564 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000060564
Domain Number - Region: 176-213
Classification Level Classification E-value
Superfamily UBA-like 0.0446
Family CUE domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060564   Gene: ENSPTRG00000009492   Transcript: ENSPTRT00000017397
Sequence length 215
Comment pep:known_by_projection chromosome:CHIMP2.1.4:17:60343558:60344205:-1 gene:ENSPTRG00000009492 transcript:ENSPTRT00000017397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGEATETVPATEQELPQPQAETGSGTASDSGESVPGLEEQDSTQTTTQKAWLVAAAEID
EEPVSKAKQSRSEKRARKAMSKLGLLQVTGVTRVTIWKSKNILFVITKPDVYKSPASDAY
IVFGEAKIQDLSQQAQLAAAEKFKVQGEAVGNIQENTQTPTVQEESEEEEVDETGVEVKD
MKLVMSQANVSRAKAVRALKNNSNDIVNAIMELTV
Download sequence
Identical sequences H2RGB8
XP_511608.1.37143 ENSPTRP00000060564 ENSPTRP00000060564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]