SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060568 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000060568
Domain Number 1 Region: 162-255
Classification Level Classification E-value
Superfamily PH domain-like 5.21e-29
Family Pleckstrin-homology domain (PH domain) 0.0000049
Further Details:      
 
Domain Number 2 Region: 28-132
Classification Level Classification E-value
Superfamily SH2 domain 3.64e-27
Family SH2 domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060568   Gene: ENSPTRG00000016309   Transcript: ENSPTRT00000075682
Sequence length 263
Comment pep:known_by_projection chromosome:CHIMP2.1.4:4:102294185:102343682:1 gene:ENSPTRG00000016309 transcript:ENSPTRT00000075682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLL
RDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETG
TLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDDLVPTAPSLGTKEGYLTKQGGLVKT
WKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLC
AKTGVEADEWIKILRWKLVKDKS
Download sequence
Identical sequences H2RGC2 J3KNB3
ENSP00000296414 NP_001293080.1.87134 NP_001293080.1.92137 XP_008953576.1.60992 ENSPTRP00000060568 ENSP00000296414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]