SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060580 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000060580
Domain Number 1 Region: 88-183
Classification Level Classification E-value
Superfamily SH2 domain 3.37e-24
Family SH2 domain 0.0000532
Further Details:      
 
Domain Number 2 Region: 227-274
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000017
Family SOCS box-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060580   Gene: ENSPTRG00000014967   Transcript: ENSPTRT00000075684
Sequence length 275
Comment pep:known_by_projection chromosome:CHIMP2.1.4:3:51404929:51408918:-1 gene:ENSPTRG00000014967 transcript:ENSPTRT00000075684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYLEHTSHCPHHDDDTAMDTPLPRPRPLLAVERTGQRPLWAPSLELPKPVMQPLPAGAFP
EEVAEGTPAQTESEPKVLDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGT
FLVRDSTHPSYLFTLSVKTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHY
VASCTADTRSDSPDPAPTPALPMPKEDAPSDPALPAPPPATAVHLKLVQPFVRRSSARSL
QHLCRLVINRLVADVDCLPLPRRMADYLRQYPFQL
Download sequence
Identical sequences A0A2I3T047
ENSPTRP00000060580 ENSPTRP00000060580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]