SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060669 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000060669
Domain Number 1 Region: 38-236
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.96e-48
Family Reprolysin-like 0.0002
Further Details:      
 
Domain Number 2 Region: 253-329
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 2.75e-19
Family Blood coagulation inhibitor (disintegrin) 0.00053
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000060669
Domain Number - Region: 484-511
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00046
Family Integrin beta EGF-like domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060669   Gene: ENSPTRG00000009284   Transcript: ENSPTRT00000073956
Sequence length 569
Comment pep:known_by_projection chromosome:CHIMP2.1.4:17:12622068:12644396:-1 gene:ENSPTRG00000009284 transcript:ENSPTRT00000073956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGTRLPVCFACPVGSSKPAEAEKEKVRRGHPTVHSETKYVELIVINDHQLFEQMRQSVV
LTSNFAKSVVNLADVIYKEQLNTRIVLVAMETWADGDKIQVQDDLLETLARLMVYRREGL
PEPSDATHLFSGRTFQSTSSGAAYVGGICSLSHGGGVNEYGNMGAMAVTLAQTLGQNLGM
MWNKHRSSAGDCKCPDIWLGCIMEDTGFYLPRKFSRCSIDEYNQFLQEGGGSCLFNKPLK
LLDPPECGNGFVEAGEECDCGSVQECSRAGGNCCKKCTLTHDAMCSDGLCCRRCKYEPRG
VSCREAVNECDIAETCTGDSSQCPPNLHKLDGYYCDHEQGRCYGGRCKTRDRQCQVLWGH
AAADRFCYEKLNVEGTERGSCGRKGSGWVQCSKQDVLCGFLLCVNISGAPRLGDLVGDIS
SVTFYHQGKELDCRGGHVQLADGSDLSYVEDGTACGPNMLCLDHRCLPASAFNFSTCPGS
GERRICSHHGVCSNEGKCICQPDWTGKDCSIHNPLPTSPPTGETERYKGPSGTNIIIGSI
AGAVLVAAIVLGGTGWGFKNIRRGRSGGA
Download sequence
Identical sequences A0A2J8IVH9
ENSPTRP00000060669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]