SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060814 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000060814
Domain Number 1 Region: 30-198
Classification Level Classification E-value
Superfamily L domain-like 1.87e-31
Family Leucine rich effector protein YopM 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060814   Gene: ENSPTRG00000002483   Transcript: ENSPTRT00000072524
Sequence length 255
Comment pep:known_by_projection scaffold:CHIMP2.1.4:GL391668.1:1341858:1364583:-1 gene:ENSPTRG00000002483 transcript:ENSPTRT00000072524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKGEKGPKGKKINLKVAKNCIKITFDGKKRLDLSKMGITTFPKCILRLSDVDELDLSRN
LIRKIPDSISKFQNLRWLDLHSNYIDKLPQSIGQMTSLLYLNVSNNRLTSNGLPVELKQL
KNIRTVNLGLNHLDSVPTTLGALKELHEVGLHDNLLNNIPVSMSKLPKLKKLNIKRNPFP
KPGESEMFIDSIRRLENLYVVEEKDLCAACLRKCQNARDNLNRIKNMATTTPRKTIFPNL
ISPNSMAKDSWEDWR
Download sequence
Identical sequences ENSPTRP00000060814 XP_016773733.1.37143 XP_016773734.1.37143 XP_016773735.1.37143 XP_016773736.1.37143 XP_016773737.1.37143 XP_016773738.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]